KEGG   Felis catus (domestic cat): 101086072Help
Entry
101086072         CDS       T02385                                 

Gene name
PADI4
Definition
peptidyl arginine deiminase, type IV
Orthology
K01481  
protein-arginine deiminase [EC:3.5.3.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.15  protein-arginine deiminase
     101086072 (PADI4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
C1
AA seq 664 aa AA seqDB search
MAQGTVIHVTPEESTYAVCVLGTESQLDVYSSAPTGCTSFSISASPGVIVDVAHGPPAKK
KPKGSSKWSLDPRLEVSLRVRDASSSTGDQKVQISYYGSKTSPIQALLYVTGVEISLSAD
ITRTGKVKPAGAQKGQRTWTWGPRGQGAILLVNCDKDNPKSSTIDCRDDRVLDSQDLQDM
SLVTLNTNTPRDFFARHQLLLHVAKSEMDKVRVFQASRGNQISRYREVLGPKQPCHPLEL
PGGQHSTDFYVEGLAFPDANFPGLISLAISLLDTSNPELPKTLVFQDSVVFRVAPWIMTP
NTQPPEEVYVCRMLENADFLKSVTALTQEAKCQLTVCTREQSVGDRWMQDEIEVGYIQAP
HKTLPVVFDSPRNRGLKEFPIKCLLGPDFGYVTRGPQTGEVSDLDSFGNLEVSPPVKVGR
KKYPLGRILIGSSCYPSNESQEMHQALQDFLSAQQVQAPVKLYSDWLFVGHVDEFLSFVP
VHKGFRLLLASPRSCYRLFQEQLKEGHGEALLFEGVKKKKQKIKDVLSNEKLRGDNSYVQ
KCIDWNREVLKRELGLTERDIVDIPQLFKLQDDLQGRLKAEAYFPNMVNMLVLGKHLGIP
KPFGPIIDDRCCLEEKVRSLLEPLGLHCTFIDDFYAYHLRHGEVHCGTNVRRRPFSFKWW
HMVP
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcccagggcacggtgatccatgtgaccccggaggagtccacctatgccgtgtgtgtc
ctgggcaccgaaagtcagctggatgtctacagctccgcccccacgggctgcacctccttc
agcatcagtgcctccccaggagtgatcgtggacgttgcccacggccctccagccaagaag
aaacccaagggctcctccaagtggtccctggacccgaggctggaggtgagcctgagggtg
agagatgccagcagcagcacaggcgaccaaaaggtccagatttcatactatggatcgaag
accagcccgatccaagccctgctctatgtcactggtgtcgaaatctccttgagcgcggac
atcacccgcaccggcaaagtgaagcctgccggagcccagaaaggccagaggacctggacc
tggggcccccgcgggcaaggcgccatcctgctggtgaactgcgacaaggacaaccccaaa
tcttccaccatagactgcagggatgatagggtgcttgacagccaagacctacaggacatg
tccctggtgaccctgaacacgaacacccccagggacttcttcgccaggcaccagctgctg
ctccacgtggccaagtcggagatggacaaagtcagggtgttccaagccagccgaggcaat
cagatctccaggtacagggaggtcctggggccaaagcagccctgtcaccccctggaactc
ccggggggccagcacagcacagacttctatgtggagggcctcgctttcccagacgccaac
ttcccggggctcatttccctcgccatctccctactggacacatccaacccggagctcccc
aagaccctggttttccaagacagtgtggtcttccgtgtggctccctggatcatgaccccc
aacactcagccccctgaggaggtgtacgtgtgcaggatgcttgaaaatgcggacttcctt
aagtcggtgacggcgctgacccaggaagccaagtgccagctgaccgtgtgcaccagggag
cagagtgtgggggaccggtggatgcaggacgagatagaggtcggctacatccaagccccg
cacaagacactgcccgtggtctttgactctccaaggaacagaggcttgaaggagttcccc
atcaagtgcttgctgggtcccgattttggctacgtgactcgagggccccaaacaggagag
gtttctgacctcgactcctttggaaatctggaagtgagccccccggtcaaggttgggagg
aagaaataccctctgggcaggatcctcattgggagcagctgctaccccagcaacgagagc
caggagatgcaccaggccttgcaggacttcctcagtgcccagcaggtgcaggcgcccgtg
aagctctactccgactggctgtttgtgggccacgtggacgagttcctgagcttcgtcccg
gtgcacaagggcttccggctgctcctcgccagccccaggtcctgctacaggctgttccag
gagcagctgaaggagggccacggcgaggctctgctatttgaaggggtcaagaaaaaaaaa
cagaaaataaaggacgttctgtccaacgagaaattgagaggagataattcgtacgtgcag
aaatgcattgactggaaccgggaggtgttaaagcgggagctgggcctgaccgagcgggac
atcgtggacatcccccagctcttcaagctccaggatgacctccaagggagactcaaggcc
gaagcctatttcccaaacatggtgaacatgctggtgctggggaagcacctgggcatcccc
aagcccttcgggcccatcatcgacgaccgctgctgcctggaggagaaggtgcggtccctg
ctggagccgctgggcctccactgcaccttcatcgacgacttctacgcgtaccacctgagg
cacggggaggtgcactgcggcaccaacgtgcgccggcggcccttctcctttaagtggtgg
cacatggtgccctga

  All links  
No link information was found.   
DBGET integrated database retrieval system