KEGG   Felis catus (domestic cat): 101086099Help
Entry
101086099         CDS       T02385                                 

Gene name
PNPLA7
Definition
patatin-like phospholipase domain containing 7
Orthology
K14676  
lysophospholipid hydrolase [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101086099 (PNPLA7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101086099 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 1351 aa AA seqDB search
MKQEEDASPEAGFCLGPVLQSWGLQLTEQRSQSTMLVGIVIGALLALALVGITVFFVYRR
VNRFRQVQPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGSTAAPRQRARKRTKVLSLA
KRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMIFVQLLEGEHVFQPGEPDTSIYVVQDGRLEVCIQDADGTEVAVKEVLAGDSVHS
LLSILDVITGHTAPYKTVSARAAVPSTVLRLPAVAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKRQVCCGSEDRLERPLRPQESCD
PDRGGSRAAAPGPLLKRSQSFPLPSVHEEILDELGKAQAGDQAPFAPPGGTAGATSDLRM
ACDRARVLLHAEERLGSSVASKSKKNVIVADTPSVVFHYSETNLDETVSSRKTDAIFRAA
KKDLLTLMKLDDTSLLDGRVTLLHVPGGTVVSRQGDQDVNILFVVSGLLHVYQRKIDSEE
DTCLFVVRPGEMVGQLAVLTGEPLIFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRVSSFVRQIDFALDWMEVEAGRAVYRQGDRSDCTYIVLSGRLRSVIRKDDGKKRLA
GEYGRGDLIGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGTASGHQFGLHTAGSKWDSGNPASNLSTVAVMPVSEDVPLTAFALELKHALG
AIGPVLLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRCI
RQADCILIVGLGEQEPAVGELERMLESTAVRAQKQLVLLHREEGPAPSRTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPKLVEMYERVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGIIRALTECGIPVDMVGGTSIGAFMGALYSEERNYSQIRIRAKQWAEDMTSMVK
TVLDLTYPITSMFSGAGFNSSICSVFKDRQIEDLWIPYFTITTDITASAMRVHTDGSLWR
YVRASMSLSGYLPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSQDETDLT
NYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSEYCEYLRPPI
DSYGTLDFGKFNEICEVGYQHGRTVFDIWGRSGVLEKMLQDRQGTSKMKACDVLTCPNAS
FTDLAEIVSRIEPAKVATVDDESDYQTEYEEELPDGSKDTYADFQSAPAHLGSDSEDEPS
LRHRYPSLASPNCPAVDMLTKMGGAPHSDAP
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagaggaagatgccagcccagaggctggcttttgtctgggtcctgtcctgcag
tcctgggggctgcagttgacggagcagcggtcacagtctaccatgctcgtggggattgtg
attggagccctcctggccctcgcccttgttggcatcaccgtcttttttgtgtataggaga
gttaaccgattccgacaggtacagcccactccgcagtacagattccgaaagagagacaaa
gtgatgttttacggcaggaagatcatgagaaaggtgaccacgctgccccacactcttgtg
gggagcacggctgccccccggcagcgggcaaggaagaggaccaaagtgctgtctttggcc
aagaggattctgcgtttcaagaaggaatacccaaccctgcagccaaaggagccaccaccc
tccctgctggaggcggatctcacagagttcgacgtgaagaattctcacctgccatcagaa
gttttgtacatgctgaagaatgtgagggtcctgggccactttgagaagccactgttcctg
gaactttgcaaacacatgatctttgtacagctgctcgaaggggaacacgtctttcagcca
ggggaaccagataccagcatctatgtagtgcaggatgggcgtctggaagtctgcatccag
gacgcggatggcaccgaggtggcggtcaaggaggttctggctggagacagcgtccacagt
ctcctcagcatcctggatgtcatcactggccacactgctccatacaaaaccgtgtccgcc
cgcgcggccgtcccttccactgtcctccggctcccagcagtggcttttcaaggagttttt
gagaagtatcctgaaaccctggtgagggtagtgcagatcatcatggtgcggctgcagagg
gtcacctttctggctctgcacaactacctgggcctgaccacagagctcttcaaccctgag
agccaggccatccccctggtgtctgtggccagcgtggctgctggcaaggccaagaggcag
gtgtgctgtggctctgaggatcgtcttgagaggcccctccggccccaggagtcctgcgat
ccagatcgagggggcagccgtgcagcagcccctgggcctctgctgaagaggagccagtcc
ttcccgctgccttccgttcacgaagagatcctggatgagctcggcaaggcccaggcaggt
gaccaggccccttttgctccaccagggggcacagcaggtgcgacctcagacctgaggatg
gcatgtgaccgtgccagggtccttctccatgcagaagaacgccttgggagctctgtggcc
agcaagtccaagaagaacgtgattgttgcagacactccctctgtggtcttccactactca
gagactaacttagatgagactgtctccagcaggaagacagatgctatcttcagagccgcc
aagaaggacctgctcaccctgatgaagctggacgacacctcgctcttggatggccgggtg
acgcttctccatgttccgggaggcacggtggtgtcgaggcagggagaccaggacgtgaac
atcctctttgtggtctcggggctgctgcatgtgtaccagcggaagatcgacagtgaggag
gacacctgcctattcgtggtgcgcccgggggagatggtgggccagctggcagtgctcacg
ggagagcccctcatcttcaccatcaaggccaacagggactgcagctttctctccatctcc
aaggcccacttctacgaaatcatgcggaagcagccaacggtggtcctgggcgtggcgcac
accgtcgtcaagcgggtgtcgtccttcgtgcggcagatcgacttcgcgctggactggatg
gaggtggaggccgggcgcgcagtgtacaggcagggagacaggtcagactgcacctacatc
gtcctcagtggccggctacgctctgtgatccgcaaggatgatggcaaaaagcgcctggcg
ggggagtatggccgcggagacctcatcggtgtggtggagacgctcacccaccaggccagg
gcgaccacagtgcatgccgttcgcgactcagagctggccaagctcccggcgggagccctg
acatccatcaagcgcaggtacccgcaggttgtgactcggctgattcatctcttgggtgag
aagattctgggcagcctccaacagggaactgcttctggtcaccagtttgggctacacact
gcaggcagcaagtgggactcggggaaccctgccagcaacctctccacggtggcggtcatg
cctgtgtcggaggatgtgcccctcaccgcctttgccctggagctgaagcacgccctcggt
gccatcggccctgtcctactgctgaccagtgacaacatcaaacagcgccttggctctgct
gctctggacagtatccacgagtaccggctgtccagctggctggggcagcaggaggacatc
caccgcatcgtgctctaccaggcggacagcacgctcacaccgtggacccagcgctgcatc
cggcaagccgactgcatcctcatcgtgggcctgggagagcaggagcccgctgtgggcgag
ctggagcggatgctggagagcacggccgtacgagcccagaagcagctggtcctgctgcac
cgggaggaggggccggcaccctcccgcaccgtggagtggctgaacatgcgcagctggtgc
tccggccacctgcacctgtgctgcccgcgccgcgtcttctcccggagaagcctgcccaag
ctggtggagatgtacgagcgagtcttccagaggcccccagatcggcactcggacttctcc
cgcctggctcgggtgctgactggcaacgccatcgccctggtgcttgggggcggaggagca
agaggctgtgcccaggttggcatcatccgggccctgacggagtgtggcatccctgtggac
atggttggagggacgtccatcggggccttcatgggcgccctatactccgaggaacggaac
tacagccagatacggatccgggccaagcagtgggctgaggacatgacgtcgatggtgaag
actgtgctggacctgacctaccccatcacctccatgttctcgggggccggctttaatagc
agcatctgtagcgtcttcaaggaccggcagatcgaggacctatggatcccctactttacc
atcaccacagacatcacagcctctgctatgcgggtccacacggacggctccctgtggagg
tacgtgcgtgccagcatgtctctgtcaggctacctgcctcccctctgcgaccccaaagac
ggacacctgctgatggacgggggctacatcaacaacctcccagcggatgtggccaggtct
atgggggcaaaggtggtgattgccattgatgtgggcagccaggatgagacggacctcacc
aactatggcgacgcgctgtctgggtggtggctgctgtggaagcgctggaaccccttggcc
acaaaagtcaaggtgttgaacatggcggagatccagacacgcctggcctatgtgtgctgc
gtccggcagctggagatggtgaagaacagtgagtactgtgagtacctgcgcccccccatc
gacagctacggtactctggactttggcaagttcaacgagatttgcgaagtagggtatcag
cacgggcggacagtgtttgacatctggggtcgaagtggtgtgctggaaaagatgctacag
gaccggcagggaacgagcaagatgaaggcgtgtgatgtcctcacctgccccaatgcctcc
ttcacggaccttgctgagattgtgtcacgcattgagcctgccaaagtagccacagtggac
gacgagtctgactaccagacggagtatgaggaggagctgccagatggctccaaggacacg
tatgctgacttccagagcgccccggcccacttgggctccgactcggaggacgaaccctca
cttcggcatcggtaccccagtctggcttccccaaactgccctgctgttgacatgctgacg
aagatgggtggagcccctcactctgatgcgccctag

DBGET integrated database retrieval system