KEGG   Felis catus (domestic cat): 101086099Help
Entry
101086099         CDS       T02385                                 

Gene name
PNPLA7
Definition
(RefSeq) patatin-like phospholipase domain-containing protein 7 isoform X1
  KO
K14676  lysophospholipid hydrolase [EC:3.1.1.5]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00564  Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    101086099 (PNPLA7)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     101086099 (PNPLA7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: cNMP_binding Patatin Podoplanin MtrF
Motif
Other DBs
NCBI-GeneID: 101086099
NCBI-ProteinID: XP_003996177
Ensembl: ENSFCAG00000003589
Position
D4
AA seq 1351 aa AA seqDB search
MKQEEDASPEAGFCLGPVLQSWGLQLTEQRSQSTMLVGIVIGALLALALVGITVFFVYRR
VNRFRQVQPTPQYRFRKRDKVMFYGRKIMRKVTTLPHTLVGSTAAPRQRARKRTKVLSLA
KRILRFKKEYPTLQPKEPPPSLLEADLTEFDVKNSHLPSEVLYMLKNVRVLGHFEKPLFL
ELCKHMIFVQLLEGEHVFQPGEPDTSIYVVQDGRLEVCIQDADGTEVAVKEVLAGDSVHS
LLSILDVITGHTAPYKTVSARAAVPSTVLRLPAVAFQGVFEKYPETLVRVVQIIMVRLQR
VTFLALHNYLGLTTELFNPESQAIPLVSVASVAAGKAKRQVCCGSEDRLERPLRPQESCD
PDRGGSRAAAPGPLLKRSQSFPLPSVHEEILDELGKAQAGDQAPFAPPGGTAGATSDLRM
ACDRARVLLHAEERLGSSVASKSKKNVIVADTPSVVFHYSETNLDETVSSRKTDAIFRAA
KKDLLTLMKLDDTSLLDGRVTLLHVPGGTVVSRQGDQDVNILFVVSGLLHVYQRKIDSEE
DTCLFVVRPGEMVGQLAVLTGEPLIFTIKANRDCSFLSISKAHFYEIMRKQPTVVLGVAH
TVVKRVSSFVRQIDFALDWMEVEAGRAVYRQGDRSDCTYIVLSGRLRSVIRKDDGKKRLA
GEYGRGDLIGVVETLTHQARATTVHAVRDSELAKLPAGALTSIKRRYPQVVTRLIHLLGE
KILGSLQQGTASGHQFGLHTAGSKWDSGNPASNLSTVAVMPVSEDVPLTAFALELKHALG
AIGPVLLLTSDNIKQRLGSAALDSIHEYRLSSWLGQQEDIHRIVLYQADSTLTPWTQRCI
RQADCILIVGLGEQEPAVGELERMLESTAVRAQKQLVLLHREEGPAPSRTVEWLNMRSWC
SGHLHLCCPRRVFSRRSLPKLVEMYERVFQRPPDRHSDFSRLARVLTGNAIALVLGGGGA
RGCAQVGIIRALTECGIPVDMVGGTSIGAFMGALYSEERNYSQIRIRAKQWAEDMTSMVK
TVLDLTYPITSMFSGAGFNSSICSVFKDRQIEDLWIPYFTITTDITASAMRVHTDGSLWR
YVRASMSLSGYLPPLCDPKDGHLLMDGGYINNLPADVARSMGAKVVIAIDVGSQDETDLT
NYGDALSGWWLLWKRWNPLATKVKVLNMAEIQTRLAYVCCVRQLEMVKNSEYCEYLRPPI
DSYGTLDFGKFNEICEVGYQHGRTVFDIWGRSGVLEKMLQDRQGTSKMKACDVLTCPNAS
FTDLAEIVSRIEPAKVATVDDESDYQTEYEEELPDGSKDTYADFQSAPAHLGSDSEDEPS
LRHRYPSLASPNCPAVDMLTKMGGAPHSDAP
NT seq 4056 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaagaggaagatgccagcccagaggctggcttttgtctgggtcctgtcctgcag
tcctgggggctgcagttgacggagcagcggtcacagtctaccatgctcgtggggattgtg
attggagccctcctggccctcgcccttgttggcatcaccgtcttttttgtgtataggaga
gttaaccgattccgacaggtacagcccactccgcagtacagattccgaaagagagacaaa
gtgatgttttacggcaggaagatcatgagaaaggtgaccacgctgccccacactcttgtg
gggagcacggctgccccccggcagcgggcaaggaagaggaccaaagtgctgtctttggcc
aagaggattctgcgtttcaagaaggaatacccaaccctgcagccaaaggagccaccaccc
tccctgctggaggcggatctcacagagttcgacgtgaagaattctcacctgccatcagaa
gttttgtacatgctgaagaatgtgagggtcctgggccactttgagaagccactgttcctg
gaactttgcaaacacatgatctttgtacagctgctcgaaggggaacacgtctttcagcca
ggggaaccagataccagcatctatgtagtgcaggatgggcgtctggaagtctgcatccag
gacgcggatggcaccgaggtggcggtcaaggaggttctggctggagacagcgtccacagt
ctcctcagcatcctggatgtcatcactggccacactgctccatacaaaaccgtgtccgcc
cgtgcggccgtcccttccactgtcctccggctcccagcagtggcttttcaaggagttttt
gagaagtatcctgaaaccctggtgagggtagtgcagatcatcatggtgcggctgcagagg
gtcacctttctggctctgcacaactacctgggcctgaccacagagctcttcaaccctgag
agccaggccatccccctggtgtctgtggccagcgtggctgctggcaaggccaagaggcag
gtgtgctgtggctctgaggatcgtcttgagaggcccctccggccccaggagtcctgcgat
ccagatcgagggggcagccgtgcagcagcccctgggcctctgctgaagaggagccagtcc
ttcccgctgccttctgttcacgaagagatcctagatgagctcggcaaggcccaggcaggt
gaccaggccccttttgctccaccagggggcacagcaggtgcgacctcagacctgaggatg
gcatgtgaccgtgccagggtccttctccatgcagaagaacgccttgggagctctgtggcc
agcaagtccaagaagaacgtgattgttgcagacactccctctgtggtcttccactactca
gagactaacttagatgagactgtctccagcaggaagacagatgctatcttcagagccgcc
aagaaggacctgctcaccctgatgaagctggatgacacctcgctcttggatggccgggtg
acgcttctccatgttccgggaggcacggtggtgtcgaggcagggagaccaggacgtgaac
atcctctttgtggtctcggggctgctgcatgtgtaccagcggaagatcgacagtgaggag
gacacctgcctattcgtggtgcgccccggggagatggtgggccagctggcagtgctcacg
ggagagcccctcatcttcaccatcaaggccaacagggactgcagctttctctccatctcc
aaggcccacttctacgaaatcatgcggaagcagccaacggtggtcctgggcgtggcgcac
accgtcgtcaagcgggtgtcgtccttcgtgcggcagatcgacttcgcgctggactggatg
gaggtggaggccgggcgcgcagtgtacaggcagggagacaggtcagactgtacctacatc
gtcctcagtggccgcctacgctctgtgatccgcaaggatgatggcaaaaagcgcctggcg
ggggagtatggccgcggagacctcatcggtgtggtggagacgctcacccaccaggccagg
gcgaccacagtgcatgccgttcgggactcagagctggccaagctcccggcgggagccctg
acatccatcaagcgcaggtacccgcaggttgtgactcggctgattcatctcttgggtgag
aagattctgggcagcctccaacagggaactgcttctggtcaccagtttgggctacacact
gcaggcagcaagtgggactcggggaaccctgccagcaacctctccacggtggcggtcatg
cctgtgtcggaggatgtgcccctcaccgcctttgccctggagctgaagcacgccctcggt
gccatcggccctgtcctactgctgaccagtgacaacatcaaacagcgccttggctctgct
gctctggacagtatccacgagtaccggctgtccagctggctggggcagcaggaggacatc
caccgcatcgtgctctaccaggcggacagcacgctcacaccgtggacccagcgctgcatc
cggcaagccgactgcatcctcatcgtgggcctgggagagcaggagcccgctgtgggcgag
ctggagcggatgctggagagcacggccgtacgagcccagaagcagctggtcctgctgcac
cgggaggaggggccggcaccctcccgcaccgtggagtggctgaacatgcgcagctggtgc
tccggccacctgcacctgtgctgcccgcgccgcgtcttctcccggagaagcctgcccaag
ctggtggagatgtacgagcgagtcttccagaggcccccagatcggcactcggacttctcc
cgcctggctcgggtgctgactggcaacgccatcgccctggtgcttgggggcggaggagca
agaggctgtgcccaggttggcatcatccgggccctgacggagtgtggcatccctgtggac
atggttggagggacgtccatcggggccttcatgggcgccctatactccgaggaacggaac
tacagccagatacggatccgggccaagcagtgggctgaggacatgacgtcgatggtgaag
actgtgctggacctgacctaccccatcacctccatgttctcgggggccggctttaatagc
agcatctgtagcgtcttcaaggaccggcagatcgaggacctatggatcccctactttacc
atcaccacagacatcacagcctctgctatgcgggtccacacggacggctccctgtggagg
tacgtgcgtgccagcatgtctctgtcaggctacctgcctcccctctgcgaccccaaagac
ggacacctgctgatggacgggggctacatcaacaacctcccagcggatgtggccaggtct
atgggggcaaaggtggtgattgccattgatgtgggcagccaggatgagacggacctcacc
aactatggcgacgcgctgtctgggtggtggctgctgtggaagcgctggaaccccttggcc
acaaaagtcaaggtgttgaacatggcggagatccagacacgcctggcctatgtgtgctgc
gtccggcagctggagatggtgaagaacagtgagtactgtgagtacctgcgcccccccatc
gacagctacggtactctggactttggcaagttcaacgagatttgcgaagtggggtatcag
cacgggcggacagtgtttgacatctggggtcgaagtggtgtgctggaaaagatgctacag
gaccggcagggaacgagcaagatgaaggcgtgtgatgtcctcacctgccccaatgcctcc
ttcacggaccttgctgagattgtgtcacgcattgagcctgccaaagtagccacagtggac
gacgagtctgactaccagacggagtatgaggaggagctgccagatggctccaaggacacg
tatgctgacttccagagcgccccggcccacttgggctccgactcggaggacgaaccctca
cttcggcatcggtaccccagtctggcttccccaaactgccctgctgttgacatgctgacg
aagatgggtggagcccctcactctgatgcgccctag

DBGET integrated database retrieval system