KEGG   Felis catus (domestic cat): 101086114Help
Entry
101086114         CDS       T02385                                 

Gene name
ASH1L
Definition
ash1 (absent, small, or homeotic)-like (Drosophila)
Orthology
K06101  
histone-lysine N-methyltransferase ASH1L [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Tight junction
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101086114 (ASH1L)
 Cellular Processes
  Cell communication
   04530 Tight junction
    101086114 (ASH1L)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101086114 (ASH1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
F1
AA seq 2965 aa AA seqDB search
MDPRNTAMLGLGSDSEGFSRKSPSAVGTGTVVSKREGELENNAKEEEDLRKWNRERNSEA
GKEDGLTDAQQQFSVKETNFSEGNLKLKIGLQAKRTKKPPKNLENYVCRPAIKTTIKHPR
KALKSGKMTDEKNEHCPSKRDPSKLYKKAGDVAAIECQSEEGIRLHSQGENSPLSKKLSP
VHSEMTDYINATSSTLVGSREPDLKDRALLNGGTSVTEKLAQLIATCPPSKSSKTKPKKL
GTGTAAGLVSKDLIRKAGVGSVAGILHKDLIKKPAISTAVGLVTKDPGKKPVFNATVGLV
NKDSVKKLGTGTTAVFINKDLGRKPGTVTTVGLLSKDSGKKLGIGIVPGLVNKDSGKKLG
LGTVVGLVNKDLGKKLSSTVGLVAKDCAKKIVANSAMGLVNKDMGKRLVSCSMAGLVSKD
AINLKAEALLPTQEPLKASCSTNISSHESQELSESLKDSTTSKTFEKNVIRQSKESILEK
FSVRKEIINLEKEMFSEGTCIQQDGFSSSDRGPYETSKHEKQPPVYCTSPDFQMGAASDA
STAKSPFSAVGESSLPSPSPTVSVNPLTRSPPETSQLAPNPLLLSPSTELMEEISESVGK
NQFTPESTHLNIGHRSVGHSMNIECKGIDKELTDSKTAHLDIPRISSSLGKKPSLTSDSS
IHAITPSVVNFTSLFSNKPFLKLGAVGASDKHCQVAESLGASLQSKPLKKRKGRKPRWTK
VVARSTCRSPKGLELERSELFKNVACSSLSGSNSEPAKFMKNIGPSSFVDHDFLKRRLPK
LSKSTAPSLALLTDSEKPAHKAFATHKLSSSMCVSSDLLSDIYKPKRGRPKAKEMPQLEG
PPKRTLKIPASKVFSLQSKEEQEPPILQPEIEIPSFKQSLSVSPFPKKRGRPKRQMRSPV
KMKPPVLSVAPFVATESPSKLESESDNHRSSSDFFESEDQLQDPDDLDDRHRPAVCSMSD
LEMDPDKKMTKRNNGQLMKTIIRKINKMKTLKRKKLLNQILSSSVESSNKGKVQSKLHNT
VSSLAATFGSKLGQQINVSKKGTIYIGKRRGRKPKTVLNGILSGSPTSLAVLEQTAQQAA
GSALGQILPPLLPSSASGSEILPSPVCSQSSGTSGGQSPVSSDAGFVEPSSVPYLHLHSR
QGSMIQTLAMKKASKGRRRLSPPTLLPNSPSHLSELTSLKEATPSPISESHSDETIPSDS
GIGTDNNSTSDRAEKFCGQKKRRHSFEHVSLIPPETSTVLSSLKEKHKHKCKRRNHDYLS
YDKTKRQKRKRKKKYPQLRSRQDPDFIADLEELISRLSEIRITHRSHHFIPRDLLPTIFR
INFNSFYTHPSFPLDPLHYIRKPDLKKKRGRPPKMREAMAEMPFMHSLSFPLSGTGFYPS
YGMPYSPSPLTATPLGLGYYGRYPPTLYPPPSPSFTPPLPPPSYMHAGHLLLNPTKYHKK
KHKLLRQEAFLTTSRTPLLSMSTYPSVPPEMAYGWMVEHKHRHRHKHREHRSSEQPQVSM
DAGSSRSVLESLKRYRFGKETVGERYKHKEKHRCHMSCPHLSPSKSLINREEQWVHREPS
ESSPLALGLQTPLQIDCSESSPSLSLGGFTPSSDPASSDEHTNLFTSAIGSCRVPNPNSS
GRKRLADSPGLFSAQDTSLTRPHRKEPLPSGERAVPTATGSQPTSEKSSQRLSESTSSSP
ARKRSSSESTSSTVNGVSSRSPRATASGDDSVDGLLQRMVQHEDQAPLGKSVEAAITSAS
VPPSSSPGHSHSHGHGKERAPGRPDSLLVPAVPGDSCSGSISLLSEKLPSSRSPPHIKRS
VVEAMQRQARKMCNYDKILATKKNLDHVNKILKAKKLQRQARTGNNFVKRRPGRPRKCPL
QAVVSMQAFQAAQLVGPELSEGEERAAAPFRPDTVTDVIEAVVQSVNLSPEQKKGLKRKS
WLLEEQTKKKQKPFPEEERERTESFTETTVEIPGPPETPAKPPEPEGSLQPVLSLIPREK
KAPRPPKKKYQKAGLYSDVYKTADPKSRLIQLKKEKLEYSPGEHEYGLFPAPIHVGKYLR
QKRIDFQLPYDILWQWKHNQLYKKPDVPLYKKIRSNVYVDVKPLSGYEATTCNCKKPDDD
TRKGCVDDCLNRMIFAECSPNTCPCGEQCCNQRIQRHEWVQCLERFRAEEKGWGIRTKEP
LKAGQFIIEYLGEVVSEQEFRNRMIEQYHNHSDHYCLNLDSGMVIDSYRMGNEARFINHS
CDPNCEMQKWSVNGVYRIGLYALKDMPAGTELTYDYNFHSFNVEKQQLCKCGFEKCRGII
GGKSQRMNGLTGSKSSQPVATHKKSGRSKEKRKSKHKLKKRRGHLSEEPSENINAPTRLT
PQLQMKPMSNRERNFVLKHHVFLVRNWEKIRQKQEEVKPASEDVHSASLCTRWNSVCRDD
GNIKSDVFMTQFSALQTARSVRTRRLAAAEENIEVARAARLAQIFKEICDGIISYKDPSR
QALAAPLLSLPPKKKNADYYEKISDPLDLATVERRILTGHYKTVEAFDADMLKVFRNAEK
YYGRKSPIGRDVCRLRKTYYNARHEASAQIDEIVGETASEADGSEASVSEKENVHEKDDD
VIRCVCGLHKDEGLMIQCDKCMVWQHCDCMGVNSDVEHYLCEQCDPRPVDREVPMTPRPH
YAQPGCVYFICLLRDDLLLRQGDCVYLMRDSRRTPDGHPVRQSYRLLSHINRDKLDIFRI
EKLWKNEKEERFAFGHHYFRPHETHHSPSRRFYHNELFRVPLYEIIPLEAVVGTCCVLDL
YTYCKGRPKGVKEQDVYICDYRLDKSAHLFYKIHRNRYPVCTKPYAFDHFPKKLTPKRDF
SPHYVPDNYKRNGGRSSWKSERPKPPLKDLGQEDDALPLIEEVLASQEQAAEEMPGLEEP
EREGAAAEASEGEKKAEESSPEPAPACTPEERRHSQRERLNQILLSLLDKIPGKNAIDVT
YLLEEGSGRKLRRRTLFIPESSFRK
NT seq 8898 nt NT seq  +upstreamnt  +downstreamnt
atggaccctagaaatactgctatgttaggattgggttctgactccgaaggattttcaagg
aagagtccctctgccgtcggtactggcacagtggtcagcaagagagaaggagagctagag
aacaacgcgaaagaggaagaggaccttcgcaagtggaatcgggaaagaaacagtgaagca
gggaaagaggatggtttgactgatgcacagcaacagttttcagtgaaagaaacaaacttc
tcagagggaaatttgaaattgaaaattggccttcaggctaagagaactaagaaacctccc
aagaacttggagaactatgtgtgtcgacctgccataaaaacaaccatcaagcacccaagg
aaagcacttaaaagcgggaagatgactgatgagaagaacgagcactgtccttcaaaacgg
gacccttcaaagttgtacaagaaagcaggtgatgttgcagccattgaatgccaatccgaa
gaaggcatccgtcttcattcacagggagaaaacagtcctttgtcgaagaagctgtctcca
gtacactcagaaatgacagattacattaatgcaacatcatctactcttgttgggagccgg
gagcctgatttaaaggaccgagcgttacttaatggaggaacgagtgtaacggagaagttg
gcacagctcatcgcaacttgccctccctctaagtcttccaagactaaaccgaagaagttg
ggaactggcactgctgcgggattggttagcaaagatttgatccggaaagcaggcgttggc
tctgtagctggaatactacataaggacttaataaaaaaaccagccatcagcacagcagtt
ggattggtaactaaagatcctgggaaaaagccagtgtttaatgcaacagtaggattggtc
aataaggactctgtgaaaaaactaggaacgggcactacggcggtgttcattaataaagac
ttaggcagaaagccaggaactgtcactacagtaggactgctgagcaaggattcaggaaag
aagctaggaattgggattgttccagggttagtgaacaaggactctggaaagaagttagga
cttggcactgtggttgggctggttaataaagacttgggaaagaaattgagttctactgtc
ggcctagtggccaaggactgtgcaaagaagattgtagcaaattcagcaatgggattagtt
aacaaggacatgggaaagagactggtgagttgctctatggcaggcctggtcagtaaagac
gccataaaccttaaagccgaagcactgctccccactcaggaaccacttaaggcttcttgt
agtacaaacatcagtagtcatgaaagtcaggaactttctgaatccctgaaagacagcacc
accagcaaaacttttgagaagaatgttatacggcagagtaaagaaagcatattggaaaag
ttctcagttcgaaaagaaatcatcaatttggagaaagaaatgttcagcgaaggaacatgc
attcagcaagacggtttctcatccagtgacagggggccttatgaaacctcaaagcatgaa
aagcaacctcccgtgtactgcacttctccggactttcaaatgggagctgcttcagacgca
tccacagcaaaatccccgttcagtgcagtaggagagagcagtctcccgtccccatcgccc
accgtatctgtcaaccctctaaccagaagtccccctgaaacttcacagctggcccctaat
ccattgcttttaagtccttccacagaattaatggaagaaatttctgaatctgttggaaag
aaccagtttactcctgaaagtacccacttgaacattggtcataggtccgtgggtcacagc
atgaacatcgaatgtaaagggattgataaagagctaactgattcaaaaaccgcgcatcta
gatattccaagaataagctcttccctgggaaaaaagccaagtttgacttccgactccagt
attcacgcaattaccccttcggttgttaacttcactagtttatttagtaacaagcccttt
ctaaaacttggtgcagtaggtgcgtcggacaaacactgccaagtggctgaaagcctaggc
gcgagtttgcagtcgaaaccattgaaaaaacggaaaggaaggaaacctcggtggactaaa
gtggtggcgagaagcacgtgccggtctcccaaagggctagagttagaaagatcagagctt
tttaagaatgttgcgtgtagctcactatcaggtagtaattctgagccagccaagtttatg
aaaaacatcggaccatcttcgtttgtagatcatgacttcctgaaacgccgattgccaaag
ctgagcaagtccacggccccgtctcttgctctcctaactgatagtgaaaaacccgctcac
aaggcttttgctactcacaagctctcctccagtatgtgtgtctctagtgaccttttgtct
gacatttataagcccaagaggggaagacctaaagctaaggagatgcctcaactggaaggg
ccacccaaaaggactttaaaaatccctgcctctaaagtgttttctttgcagtctaaggag
gaacaggaacccccgattttacagccagaaatcgaaattccttccttcaagcaaagtctt
tctgtgtctccttttccgaaaaagagaggcagaccgaagaggcagatgaggtcaccagtc
aagatgaagccacctgtactatccgtggctccgtttgttgccaccgagagtccaagcaag
ctggagtctgaaagtgacaaccatcggagcagcagtgatttctttgagagtgaggatcag
cttcaggacccagacgatctggacgacaggcataggcccgctgtctgcagcatgagtgac
ctagagatggatccagataaaaaaatgaccaagagaaacaacggacagctaatgaaaaca
attatccgcaaaataaataaaatgaagactttgaagaggaagaaactgctgaatcagatt
ctgtcaagctccgtagaatcaagtaataaagggaaagtgcaatccaaactccataataca
gtgtccagtcttgccgccacgtttggctctaaattgggccagcagataaacgtcagcaag
aaaggaaccatttacataggaaagagaaggggtcgaaaaccaaaaactgtcttaaacggc
attctttctggtagccctaccagccttgctgtccttgagcaaactgctcagcaggcagct
ggctcggcattaggacagatccttccccctttgctgccctcctctgctagtgggtcagag
attctcccgtcacctgtgtgctcccagtcttctgggactagtgggggtcagagccctgtg
agcagtgacgcgggcttcgtggaacccagttcagtgccgtatctgcatttacactccaga
cagggcagtatgatccagacgcttgcaatgaagaaggcctcaaaggggaggaggcgactg
tctcctcctactttgttgccgaattctccctcccacttaagtgaactcacctccctgaag
gaggccactccttctcccattagtgagtctcacagcgacgagaccattcccagcgatagt
ggaatcggaaccgataataacagcacttcggaccgagcagagaagttttgtggacagaaa
aagaggcggcactcgtttgaacatgtttctctgattccccctgaaacctctacagtcctg
agcagtcttaaagaaaaacataaacacaaatgtaagcgcaggaatcacgattacctcagc
tatgacaagacgaagaggcagaaacgaaaacggaaaaagaaatacccccagctccgaagc
aggcaggatccagactttattgcagatctggaggaactgataagtcgtctgagtgaaatt
cgaatcacccatcgaagtcatcactttatcccccgagacctgctgcccactatttttcgc
atcaactttaatagcttctatacacatccttctttccccttggaccctttgcactacatt
cgaaaacctgacttaaaaaagaagagagggagaccccctaagatgagggaggcaatggcc
gaaatgcccttcatgcacagccttagttttcctctttccggtacaggattctatccgtcc
tacggcatgccttactctccgtcaccccttacagccactcccctgggactaggttactat
ggaaggtacccccccactctctaccctcctccgtctccctctttcactcctccgcttcca
cctccttcctacatgcatgctggtcacttacttctcaaccccaccaaataccataagaaa
aagcataagctactgcgacaggaggcctttctcacaaccagcaggactcctctcctctcc
atgagcacctaccctagcgtccctcccgagatggcctatggttggatggtcgagcacaaa
cataggcaccgtcacaagcacagagaacaccgctcttctgagcaaccccaggtttccatg
gacgccggctcttccagatctgttttggagtccttgaaacgctatcgatttgggaaggaa
actgttggagagcgatataagcataaggaaaagcaccgatgtcatatgtcctgccctcat
ctctctccttcgaaaagcttaataaatcgagaagaacagtgggtccaccgagagccttca
gaatctagtccactggctttgggattgcaaacacctttacagatcgactgttcagagagt
tctccgagcttatccctgggagggttcactcccagctctgacccggccagcagcgatgag
catacaaaccttttcacaagtgcaataggcagctgccgagtccccaacccgaactccagc
ggccggaagagactagctgacagtcctggactgttttctgcacaggacacttcgctcact
cggcctcacaggaaggagccactgccttccggcgagagggcagtgccgaccgcgacaggt
tcccagccaacctcagagaagtcttcccagcgactgtccgagagcacgagcagcagccct
gcccggaagcggtcgtcctcggagagcacttcgtccacagtgaatggcgtttcctctcga
agtccgagagcgaccgcttctggggacgactccgtggacggtctgctgcagcggatggta
caacatgaggaccaggcgcccctggggaagagcgtcgaggccgcgatcacatctgcctct
gtgccgccttcctccagtccgggccacagccacagccacggccacggcaaggagcgagcc
ccggggagaccagacagccttctcgtgcctgcggtccccggcgactcctgcagtggtagc
atctcactcctctccgagaagttgccgagcagccgttcgcccccgcacatcaagaggagc
gtagtggaagccatgcagcgccaagctcggaaaatgtgcaattacgacaaaatcctggcc
accaagaaaaacctggaccatgtcaacaaaatactaaaagccaaaaaactgcaaagacag
gccaggacagggaacaacttcgtgaaacgcagaccaggccgacctcggaaatgccccctc
caggccgtggtgtcgatgcaagccttccaagccgcccagttggtcggccccgagctgagc
gaaggcgaggagagagcagcggcgcccttccgtcctgacaccgttacggatgtcatcgag
gctgttgtccagagcgtgaacctgagtccagaacagaagaaggggttgaagaggaaaagt
tggcttttggaagaacagaccaagaaaaagcagaagccgttcccagaggaagaacgagag
cgcactgaaagctttactgaaacaacagttgagattcccggtcctcctgaaaccccagcc
aagcctcccgaacctgaaggtagcttgcagcctgtgctttctctcatcccaagggagaag
aaggccccacgtcccccaaagaagaagtatcagaaagcagggctgtattctgacgtttac
aaaactgcagacccaaagagccggctgatccaattaaagaaggagaagctggaatacagc
cctggagagcacgagtacgggttattcccagcccccattcatgtcggaaagtatctaagg
caaaagagaattgacttccagcttccctatgacatcctttggcagtggaaacataatcag
ctatacaaaaagccagatgtcccactatataaaaaaatccgttcaaatgtctacgttgat
gtcaaacccctttctggttacgaggccaccacctgtaactgtaagaagccagatgatgat
accaggaagggctgtgtggatgactgtctcaatagaatgatctttgctgaatgttccccc
aacacttgtccctgtggtgagcagtgctgtaaccagaggatacagaggcatgagtgggtg
cagtgtctagaacgatttcgagctgaggaaaaaggttggggaatccgaaccaaagaaccc
ctaaaagccgggcagttcatcatcgagtacctgggggaggttgtcagcgagcaagagttc
aggaacaggatgattgagcagtatcataatcacagcgaccactactgcctgaacctggat
agcgggatggtgatcgacagttaccgcatggggaatgaggcccgattcatcaaccacagc
tgcgatcccaactgtgagatgcagaaatggtctgtcaatggagtgtaccggatcggactg
tatgctcttaaagacatgccagctggtaccgagctcacctacgattacaacttccattcc
tttaacgttgaaaagcagcaactgtgcaagtgtggctttgagaagtgtcgagggatcatc
gggggcaagagtcagcgcatgaacgggctcaccggcagcaaaagcagccagcctgtggcc
actcacaagaagtctggacggtcaaaggagaagaggaagtctaagcacaagctgaagaaa
aggagaggccacctctccgaagagcccagtgaaaacatcaacgctcccacaaggttgacc
ccccagttacaaatgaagccgatgtctaatcgagaaaggaattttgtgttaaagcatcat
gtgttcttggtccggaactgggagaagatccggcagaaacaggaggaggtaaagcccgcc
agcgaggatgttcactcagcatcgctgtgtacgcgctggaacagcgtctgccgagatgac
gggaacatcaagtccgatgtcttcatgacccagttctccgccctgcagacggcacgatct
gttcgaacgcgacggctggcagcagctgaggagaacattgaggtggcgcgggcagcccgc
cttgcccagatcttcaaagagatctgtgacggcatcatctcctacaaagatccttcccga
caagccctggccgcgccccttctgagcctccccccgaagaaaaagaacgctgattattac
gagaagatctctgaccccctggacctggccaccgtagagaggcgcatcctcaccggccac
tacaagaccgtggaggcttttgacgccgacatgctcaaggtctttcggaatgctgagaag
tactacgggcgtaaatcccccatcgggagagatgtctgccgcctgcggaagacctactac
aacgcccggcacgaggcgtcggcccagatcgacgagatcgtgggagagacggcgagcgag
gcagacggcagcgaggcctccgtctccgagaaggagaacgtgcacgagaaggacgacgac
gtcatccgctgtgtgtgtggcctgcacaaggacgaaggcctcatgatccagtgtgacaag
tgcatggtgtggcagcactgtgactgtatgggggtgaactcagacgtggagcactacctc
tgtgagcagtgtgacccgaggcctgtggacagagaggtacccatgacccctcggccccac
tacgcccagcccggctgtgtctacttcatctgtttgctccgagatgacctgttgcttcgt
caaggcgactgtgtgtatttgatgcgggacagccggcgcacccctgacggccaccccgtc
cgccagtcctaccgactgttgtcacacatcaatcgagacaaacttgacatctttcgcatt
gagaagctttggaagaatgaaaaagaggagcggtttgcctttggtcaccactatttccgc
ccccacgagacccaccactccccctctcgccgcttctatcacaacgagctgtttcgggtg
ccgctgtacgagatcattcccttggaggccgtggtggggacctgctgtgtactggacctt
tacacatattgcaaagggagacccaaaggggtgaaggagcaggacgtgtacatctgtgac
tatcggctcgacaagtccgcacacctgttttacaagatccaccggaaccgctatcccgtc
tgcaccaagccctacgcctttgaccacttccccaagaagctcactcccaaaagagatttc
tcgccgcattacgtcccagacaactacaagaggaacggagggcggtcctcctggaagtct
gagcgcccaaagccacccctaaaagacctgggccaggaggacgatgctctgcccttgatt
gaagaggtcctggccagccaggagcaagccgctgaggagatgcccggcctggaggagccg
gagcgggagggggccgccgcagaagcgagcgaaggcgagaagaaggcggaggagagcagt
ccggagccggcgcctgcctgtacccctgaggagcgacggcacagccagcgggaacgactc
aaccagatcttgctcagtctcctggacaaaatccccggaaaaaatgccatcgacgtgacc
tacctgctggaggaaggatccggcaggaagctccgaagacgcactttgttcatcccagag
agcagcttccggaagtga

DBGET integrated database retrieval system