KEGG   Felis catus (domestic cat): 101086390Help
Entry
101086390         CDS       T02385                                 

Gene name
EGR3
Definition
(RefSeq) early growth response protein 3 isoform X1
  KO
K12497  early growth response protein 3
Organism
fca  Felis catus (domestic cat)
Pathway
fca04625  C-type lectin receptor signaling pathway
fca05161  Hepatitis B
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Immune system
   04625 C-type lectin receptor signaling pathway
    101086390 (EGR3)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101086390 (EGR3)
  Infectious diseases
   05161 Hepatitis B
    101086390 (EGR3)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Zinc finger
   Cys2His2 developmental/cell cycle regulators, Egr/Krox
    101086390 (EGR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: zf-H2C2_2 zf-C2H2 zf-C2H2_4 DUF3446 zf-C2HC_2 zf-met zf-BED zf-C2H2_6 Zf_RING zf-H2C2_5
Motif
Other DBs
NCBI-GeneID: 101086390
NCBI-ProteinID: XP_003984748
Ensembl: ENSFCAG00000005668
UniProt: M3W4H4
Position
B1
AA seq 387 aa AA seqDB search
MTGKLAEKLPVTMSSLLNQLPDNLYPEEIPSALNLFSGSSDSVAHYNQMATENVMDIGLT
NEKPNPELSYSGSFQPAPGNKTVTYLGKFAFDSPSNWCQDNIISLMSAGILGVPPASGAL
STQTSTASMVQPPQGDVEAMYPALPPYSNCSDLYSEPVSFHDPQGNPGLAYSPQDYQSAK
PALDSNLFPMIPDYNLYHHPNDMGSIPEHKPFQGMDPIRVNPPPITPLETIKAFKDKQIH
PGFGSLPQPPLTLKPIRPRKYPNRPSKTPLHERPHACPAEGCDRRFSRSDELTRHLRIHT
GHKPFQCRICMRSFSRSDHLTTHIRTHTGEKPFACEFCGRKFARSDERKRHAKIHLKQKE
KKAEKGGAPSASSAPPVSLAPVVTTCA
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
atgaccggcaaactcgccgagaagctgccggtgaccatgagcagtttgctaaaccaactg
cctgacaatctgtaccccgaggagatccccagcgcgctcaacctcttctctggcagcagc
gactcggtagcccattacaatcagatggctacagagaatgtgatggacatcggtctgacc
aacgagaagcccaacccggaactctcttattcgggctccttccagccagcccccggcaac
aagaccgtgacctacttgggaaagttcgccttcgactccccttccaactggtgtcaggac
aacatcattagcctcatgagcgccggcatcttgggagtgcccccggcctcaggggcactc
agcacgcagacctccacggccagcatggtgcagccaccgcagggcgacgtggaggccatg
tatccggcgctgcccccctattctaactgcagtgatctctactcggagcctgtgtctttc
cacgacccccagggcaaccctgggctcgcctattccccccaggattaccaatcggccaag
ccggccttggacagcaacctcttccccatgattcctgactacaacctataccaccatccc
aacgacatgggctccattccggagcacaagcccttccagggcatggaccccatccgggtc
aatccgccccctattacccctctggagaccatcaaggcattcaaagacaagcagatacac
ccgggctttggcagcctgccccagccgccgctcacgctcaagcccatccggccccgcaag
tatcccaaccgacccagcaagaccccgctccacgagcggccccacgcgtgcccggcggag
ggctgcgaccgccgtttcagccgctcggacgagctgacccggcacctgcgcatccacacg
ggccacaagcccttccaatgccggatttgcatgaggagcttcagtcgcagcgaccacctt
accactcacatccgcacgcatacgggcgagaagccctttgcctgcgagttctgcgggcgc
aagtttgcgcgcagcgacgagcgcaagcgccacgccaagatccacctcaagcaaaaggag
aagaaggcggagaaggggggtgcgccctctgcgtcctcggcgccccccgtgtccctggcc
cctgtggtcaccacctgcgcctga

DBGET integrated database retrieval system