KEGG   Felis catus (domestic cat): 101086431Help
Entry
101086431         CDS       T02385                                 

Gene name
USP20
Definition
ubiquitin specific peptidase 20
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D4
AA seq 913 aa AA seqDB search
MGDSRDLCPHLDSIGEVTKEDLLFKSKGACQSCGVTGPNLWACLQVSCSYVGCGESFADH
STIHAQAKKHNLTVNLTTFRVWCYACEKEVFLKQRLAAPLAGPSPKFSEQDPPLPSHPLK
AVPIAVADEGESESEDDDLKPRGLTGMKNLGNSCYMNAALQALSNCPPLTQFFLECGGLV
RTDKKPALCKSYQKLVSEVWHRKRPSYVVPTSLSHGIKLVNPMFRGYAQQDTQEFLRCLM
DQLHEELKEPVVAAAAALAEARDSDSSDTDEKREGDRSPSEDEFLSCDSSSDRGEGDGQV
RGGGGSQAEAELLTPDEAGRAISEKERMKDRKFSWGQQRTSSEQVDEDADVDTAMAALDD
QPAEARPPSPRSPSPCRTPEPDNEAHMRSASRPCSPVRHHEGHAKLASSPPRASPVRMGP
SYVLKKAQVLSAGSRRRKEQHYRSVISDIFDGSILSLVQCLTCDRVSTTVETFQDLSLPI
PGKEDLAKLHIYQNVPAKPGACGDGYAAQGWLAFIVEYIRRFVVSCTPSWFWGPVVTLED
CLAAFFAADELKGDNMYSCERCKKLRNGVKYCKVLRLPEILCIHLKRFRHEVMYSFKISS
HVSFPLEGLDLRPFLAKECTSQITTYDLLSVICHHGTAGSGHYIAYCQNVINGQWYEFDD
QYVTEVHETVVQNAEAYVLFYRKSSEEAVRERQQVVSLAAMREPSLLRFYVSREWLNKFN
TFAEPGPITNHTFLCSHGGIPPNKYHYIDDLVVILPQNVWEHLYNRFGGGPAVNHLYVCS
ICQVEIEALAKRRRIEIDTFIKLNKAFQAEESPSVIYCISMQWFREWEAFVKGKDNEPPG
PIDNSRIAQARGSGHIQLKQGADYGQISEETWVYLNNLYGGGPEIAIRQSVAQLQDPESL
HGEQKIEAETRAV
NT seq 2742 nt NT seq  +upstreamnt  +downstreamnt
atgggggactccagggacctttgccctcaccttgactccataggggaggtgaccaaagag
gacttgctgttcaaatctaagggagcctgtcagtcgtgtggtgttactggaccgaacctg
tgggcctgtctccaggtctcctgctcctatgttggctgcggagaatccttcgctgaccat
agcaccattcacgctcaggcaaaaaagcacaacctgacagtgaacctgaccacgttccgg
gtgtggtgttacgcctgtgagaaggaagtgttcctgaagcagaggctggcagcacccctg
gcgggcccctcgcccaaattctcggagcaggaccctccgctgccctcgcaccctctgaaa
gctgtccctattgccgtggccgacgaaggagagtccgagtcagaggatgatgacctgaaa
cctcgaggcctcacgggtatgaagaacctcggcaactcctgctacatgaacgccgccttg
caggccctgtccaactgccctccgctcacccagttcttcttggagtgtggaggcctggtg
cgcacagacaagaagccagccctgtgcaaaagttaccagaagctggtctctgaggtctgg
cacaggaaacgcccaagctacgtggttcccaccagcctgtctcacgggatcaagttggtc
aacccgatgttccgaggctatgcccagcaggacacccaggagttcctgcgctgcctgatg
gaccagctgcacgaggagctcaaggagcccgtggtggcggccgcggcggcactggccgag
gcccgggactcagactcgagcgacacggacgagaagcgcgagggcgaccggagcccgtcc
gaggacgagttcctgtcctgtgactcgagcagcgaccggggtgagggcgatgggcaggtc
cgtggcgggggcggctcgcaggccgaggcggagctgctgacccccgacgaggcgggccgc
gccatctccgagaaggagcgcatgaaggaccgcaagttctcctggggccagcagcgcacc
agctcggagcaagtggacgaggacgccgacgtggacacggccatggccgccctcgacgac
cagcccgcagaggcccggccgccgtcgccgcggtcccccagcccctgccggaccccagag
ccggacaacgaggcccacatgcgcagcgcctcccgcccctgcagccccgtgcgccaccac
gagggccacgccaagctggccagcagccctcctcgggcgagccccgtgaggatggggccg
tcgtacgtgctcaagaaagcccaggtactgagtgccggcagccggaggcggaaggagcag
cactaccgcagcgtgatctccgacatcttcgacggctccatcctcagcctcgtgcagtgt
ctcacctgtgaccgggtgtccaccacggtagagacgttccaggacctgtcgctgcccatt
cctggcaaggaggacctggccaagctgcacatctaccagaacgtgccagccaagccgggc
gcctgcggggacggctacgccgcccagggctggctcgccttcatcgtggagtatatccgg
aggtttgtggtatcctgtacccccagctggttttgggggccggtcgtcaccctggaagac
tgccttgctgccttcttcgctgctgatgagctgaagggcgacaacatgtacagctgtgaa
cggtgtaaaaagctgcggaacggggtgaaatactgtaaggtcctgcggctgcccgagatc
ctgtgcatccacctgaagcgctttcggcacgaggtcatgtattcgttcaaaatcagcagc
cacgtctccttccccctcgagggacttgacttgcgtccattccttgccaaggagtgcacg
tcgcagatcaccacctacgacctcctctctgtcatctgccaccacggcacagcaggcagt
ggccactacatcgcctactgccagaatgtcatcaacgggcaatggtacgagttcgatgac
cagtatgtcactgaggtccacgagacggtggtgcagaacgccgaggcctacgtcctcttc
tacaggaagagcagcgaggaggctgtgcgggagcggcagcaggtggtatccctggccgcc
atgcgggagcccagcctgctgcggttctacgtgtcccgggaatggcttaacaagttcaac
accttcgcggagccggggcccatcaccaaccacaccttcctctgctcccacggaggcatc
ccgcccaacaaataccactacatcgacgacctggtagtgatcctgccccagaacgtctgg
gagcacctctacaacaggtttgggggcggccctgccgtgaaccacctgtacgtgtgctcc
atctgccaggtggagatagaggccctggccaagcgcaggcggattgagatcgacaccttc
attaagctcaacaaagccttccaggccgaggagtcccccagcgtcatctactgcatcagc
atgcagtggttccgggagtgggaagcctttgtcaagggcaaggacaatgagccccccggg
cccattgacaacagcaggatcgcacaggccaggggaagcggccacattcaactgaagcag
ggagctgactatgggcagatttcggaggagacctgggtctacctgaacaacctgtatggc
ggtggccccgagatcgccatccgacagagtgtggcccagctccaggacccagagagctta
cacggggagcagaagatcgaagccgagacccgggccgtgtga

DBGET integrated database retrieval system