KEGG   Felis catus (domestic cat): 101086483Help
Entry
101086483         CDS       T02385                                 

Gene name
CHP1
Definition
calcineurin-like EF hand protein 1
Orthology
K17610  
calcineurin B homologous protein 1
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
B3
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcttccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacccgcctctacagccgattcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccaacggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccggagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcattttcgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaatagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgacaagatttcccgtgatgagctattacaggtgctacgt
atgatggtcggagtaaatatctcagatgagcagctgggcagcattgcagacaggaccatc
caggaggctgatcaggatggggacagcgccatctcttttacagagtttgttaaggttttg
gagaaggtggacgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system