KEGG   Felis catus (domestic cat): 101086483Help
Entry
101086483         CDS       T02385                                 

Gene name
CHP1
Definition
(RefSeq) calcineurin B homologous protein 1
  KO
K17610  calcineurin B homologous protein 1
Organism
fca  Felis catus (domestic cat)
Brite
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101086483 (CHP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_6 EF-hand_1 EF-hand_7 EF-hand_8 EF-hand_5 SPARC_Ca_bdg RST
Motif
Other DBs
NCBI-GeneID: 101086483
NCBI-ProteinID: XP_003987313
Ensembl: ENSFCAG00000006346
UniProt: A0A2I2V0W7
Position
B3
AA seq 195 aa AA seqDB search
MGSRASTLLRDEELEEIKKETGFSHSQITRLYSRFTSLDKGENGTLSREDFQRIPELAIN
PLGDRIINAFFPEGEDQVNFRGFMRTLAHFRPIEDNEKSKDVNGPEPLNSRSNKLHFAFR
LYDLDKDDKISRDELLQVLRMMVGVNISDEQLGSIADRTIQEADQDGDSAISFTEFVKVL
EKVDVEQKMSIRFLH
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atggggtctcgggcttccacgttattgcgggacgaagagctcgaggagatcaagaaggag
actggcttttcccacagtcagatcacccgcctctacagccgattcaccagcctggacaaa
ggagagaatgggactctcagccgggaagatttccaacggattccagaacttgccatcaac
ccactgggggaccggatcatcaatgccttctttccggagggagaggaccaggtaaacttc
cgtggattcatgagaactttggctcattttcgacccattgaggataatgaaaagagcaaa
gatgtgaatggaccagaaccactcaatagccgaagcaacaaactgcactttgcttttcga
ctatatgatttggataaagatgacaagatttcccgtgatgagctattacaggtgctacgt
atgatggtcggagtaaatatctcagatgagcagctgggcagcattgcagacaggaccatc
caggaggctgatcaggatggggacagcgccatctcttttacagagtttgttaaggttttg
gagaaggtggacgtagaacagaaaatgagcatccgatttcttcactaa

DBGET integrated database retrieval system