KEGG   Felis catus (domestic cat): 101086512Help
Entry
101086512         CDS       T02385                                 

Gene name
TESK1
Definition
testis-specific kinase 1
Orthology
K08841  
testis-specific kinase 1 [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D4
AA seq 636 aa AA seqDB search
MVLWFGLKKNPRLSKVASCSQLPANARLGGVLRMERRHSSLAIIGYFADPRGEEPAENRK
RWVRFHCAEKIGAGFFSEVYKVRHRQSGQVMVLKMNRLPSNRGNTLREVQLMNRLRHPNI
LRFMGVCVHQGQLHALTEYMNGGTLEQLLSSPEPLSWPVRLHLALDIARGLRYLHAKGVF
HRDLTSKNCLIRREDQGFTAVVGDFGLAEKIPVYREGARKEPLAVVGSPYWMAPEVLRGE
LYDEKADVFAFGIVLCELIARVPADPDYLPRTEDFGLDVPAFQTLVGDDCPLPFLLLAIH
CCSMEPSTRAPFTEITQHLEWILEQLPEPSPLTRAPLTHNQRSVSRGGPSATLPRPDPRL
SRSRSDLFLPPSPESPPNWGDNLTRVNPFSLREDLRGGKIKLLDTPSKPVAPLPLVPPSP
LPSTQLPLVTTPETLVQPGTPARRCRSLPSSPELPRRMETALPGPGPPTVGPSAEERMEC
EGSSPEPEPPGPAPQLPLAVATDNFISTCSSASQPWSPRSGPTLNNNPPAVVVNSPQGWA
GEPWNRAQHSLPRAAALERTEPSPPPSAPRESDEGLPCPGCCLGPFSFGFLSMCPRPTPA
VARYRNLNCEAGSLLCHRGHHAKPPTPGLQLPGARS
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atggtactgtggtttggtttaaagaagaatcctcgtctttcaaaggtggcaagctgctca
cagctgcctgcaaacgctcgcctgggaggcgtcctccggatggagcgtcgtcactcatcc
ctggcgataattggctatttcgccgacccccggggggaggagccagcagagaaccggaag
cgttgggttcgtttccactgcgccgagaagatcggggccggcttcttctctgaggtctac
aaggttcggcaccgacagtcagggcaagtcatggtgctgaaaatgaacagactccccagt
aaccggggaaacacgctacgggaggtgcagctgatgaaccggctccgacacccgaacatc
ctaaggttcatgggggtctgtgtgcaccaggggcagctgcacgctcttacagagtatatg
aatgggggaacccttgaacagctgctcagctctccggaacccctgtcctggcctgtcagg
ctccacctggctctggacattgcccgcggcctgcggtacctgcatgccaaaggtgtattc
caccgagacctaacatccaagaactgtctgatccgacgggaagaccaaggtttcacggct
gttgtgggtgacttcgggctggctgaaaagattcctgtgtatagggaaggggcaagaaag
gagccattggctgtggtaggttccccatactggatggctccagaggtgttgcggggtgag
ctgtatgatgagaaggctgatgtctttgcctttgggattgtcctctgtgagctcattgca
cgagtacctgccgacccagattacctaccccgtactgaggacttcggcctggatgtgcct
gctttccagaccctggtaggggatgactgcccactgcccttcctgctcctggccatccac
tgctgcagtatggaacccagcactcgtgctcccttcaccgaaatcacccagcacctggaa
tggatccttgagcagctgcctgagccatcccccctcaccagggctcccctgacacacaat
cagaggtctgtttcaagagggggtccgtctgccacacttcctaggccagacccccggctt
tcccgaagccggtcagacctcttcctgcccccatcaccggaatcaccccccaactggggg
gacaatctgactcgagtcaaccccttttcactccgggaagacctcaggggaggcaagatc
aagctgttggacacacccagcaagccagtcgcccccctgccccttgtaccaccatcacca
ctgccctccacccaactgcccttggtgaccactccagagaccctggtccagcctgggaca
cctgcccgtcgctgccgctcgctaccatcatcccctgaacttccccgacgtatggagaca
gcactgccaggtcctggcccccccactgtgggcccctcggctgaagaaagaatggagtgt
gagggcagtagccctgagccagaacccccaggaccagctccccagctgcccctggccgtg
gccacagacaacttcatcagcacttgttcctcagcctcccagccctggtcccctagatca
ggacctacccttaacaacaaccccccagctgtggtggtgaactccccacaaggctgggct
ggggagccctggaaccgggcccagcatagcctgccccgggcagcagccctggagcggaca
gaaccctcgccgcccccctcagctccccgggagtctgatgaggggctgccctgccctggc
tgctgtcttggcccgttcagctttggcttcctgtccatgtgcccccgccccacaccagct
gttgctcgctaccgcaacctgaactgtgaggcgggcagtctcctctgccaccgagggcac
catgccaagcctcccacacccggcctgcagctgcctggggcacgctcttag

DBGET integrated database retrieval system