KEGG   Felis catus (domestic cat): 101086518Help
Entry
101086518         CDS       T02385                                 

Gene name
PLCD3
Definition
phospholipase C, delta 3
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101086518 (PLCD3)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101086518 (PLCD3)
   04070 Phosphatidylinositol signaling system
    101086518 (PLCD3)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101086518 (PLCD3)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101086518 (PLCD3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 815 aa AA seqDB search
MTRCSSEIRMLTGHPEFYLDNAVSPEPLSVPVPLMPRPAPNPPSKQSTEWAESCSLSSPA
CTHHWLPQGQEGALPMACPGRLLQGLTEDEDVRAMLRGSRLCKIRSRTWHKERLYRLQED
GLSVWFQRRIPRAPSQHIFFVQHIEAVREGHQSEGLRRFGGAFPPARCLTIAFKGRRKNL
DLAAATPEEAQRWVRGLAKLRARLDAMSQRERLDHWIHSYLHRADSNQDSKMSFKEIKSL
LRMVNVDMNDMYAYRLFKECDHSNNERLEGAEIEEFLRRLLKRPELEEIFHRYSGEDRVL
SAPELLEFLEDQGEDGATLAHAQQLIHTYELNETAKQHELMTLDGFMMYLLSPEGAALDP
AHTCVFQDMDQPLSHYFISSSHNTYLTDSQIGGPSSTEAYVRAFAQGCRCVELDCWEGPG
GEPVIYHGHTLTSKILFRDVVQAVRDHAFTLSPYPVILSLENHCGLEQQAVMARHLRAIL
GDVLVTQALDSQNPEELPSPEQLKGRVLVKGKKLPVARSDDGRILSDQEEEDEEEEEAEA
TEQRRRAKQISPELSALAVYCCATRLRTLRPNPVPPQPCQVSSLSERKAKKLIREAGNSF
VRHNTRQLTRVYPLGLRMNSANYSPQEMWNSGCQLVALNFQTPGYEMDLNAGRFLINGQC
GYILKPACLRQPDTTFDPECPGPPRTTLTIQVLTAQQLPKLNTEKPNSIVDPLVRVEIHG
VPADCARKETNYVLNNGFNPRWGQTLQFQLRAPELVLVRFVVEDYDTTSPNDFVGQFTLP
LNSLKQGYRHIHLLSKDGASLSPATLFVHIRIQRF
NT seq 2448 nt NT seq  +upstreamnt  +downstreamnt
atgactcgttgttcatctgaaattcgaatgttaactgggcaccctgaattttatcttgac
aacgctgtctccccagagcccctgtctgtgcctgtgcccctgatgccccgccctgcccct
aatcctcccagcaagcagagcactgagtgggcagaatcctgctccctttcctccccagcc
tgcacgcaccactggttgccacaggggcaagagggggctctccccatggcctgcccagga
cgtcttctgcagggcctgacggaggacgaggacgtgcgcgccatgctgcggggctcccgg
ctctgcaagatccgctcacggacgtggcacaaggagcggctgtaccggctgcaggaggac
ggcctgagcgtgtggttccagcggcgcatcccgcgcgcgccgtcgcagcacatcttcttc
gtgcagcacatcgaggcggtccgcgagggccaccagtccgagggcctgcgacgcttcggg
ggcgccttcccgccggcgcgctgcctcaccatcgccttcaagggccgccgcaagaacctg
gacctggcggcggccaccccggaggaggcgcagcgctgggtgcgcggtctggccaagctg
cgcgcgcgcctcgacgccatgagccagcgcgagcgcctcgatcactggatccactcctat
ctgcaccgggccgactcgaaccaggacagtaagatgagcttcaaggagatcaagagcctg
ctcagaatggtcaacgtggacatgaacgacatgtatgcctaccgcctctttaaggagtgc
gaccactccaacaatgagcggctggagggggctgagattgaggagtttctgaggcggctg
ctgaaacgccccgagttggaggagatcttccatcggtactccggcgaggaccgcgtgctg
agcgcccctgagctgttggagttcctggaggaccagggcgaggatggcgccacgctggcc
catgcccagcagctcatccacacctatgagctcaatgagacagccaagcagcatgagctg
atgacactggatggcttcatgatgtacctgttgtcacccgaaggggctgctctggaccca
gcccacacatgtgtgttccaggacatggaccagcccctctcccactacttcatctcctcc
tcgcacaatacctatctgactgactctcagatcggggggcccagcagcaccgaggcctat
gttagggcctttgcgcaggggtgccgctgtgtggagctagactgctgggaggggccagga
ggggagcccgtcatctaccacggccacaccctcacctctaagatcctcttccgagatgtg
gtccaggctgtgcgtgaccacgccttcactctgtccccataccctgtcatcctgtccctt
gagaaccactgcgggctggagcagcaggctgtcatggcccgccatcttcgcgccatcctg
ggagacgtgctggtgacacaagcgctggactcccagaaccccgaagagttgccatcccca
gagcagctgaagggccgggtcctggtgaaggggaagaagctgccagttgctcggagcgat
gacggtcgaattctgtccgaccaggaggaggaagacgaagaagaagaagaggcagaggcc
acagaacagaggcggcgggccaagcagatctcccctgagctgtcggccctggccgtgtac
tgctgtgccacccgcctgcggaccctgcgccccaacccggtcccaccccagccctgccag
gtcagctccctcagtgagcgcaaggccaagaagctcatccgagaggcagggaacagcttc
gtcaggcacaatacccgacaactgacccgtgtctacccactggggctgcggatgaactcc
gccaactacagcccccaggagatgtggaactcaggctgtcagcttgtggccttgaacttc
cagacaccaggctacgagatggacctcaatgctggccgcttcctcatcaacgggcagtgc
ggctacatcctgaaacctgcctgcctgcgacagcccgacacaacttttgaccctgagtgt
cctggaccccccagaactactctcaccatccaggttctgactgcgcagcagctgcccaag
ctgaacaccgagaagccaaactccatcgtggaccccctggtgcgtgtcgagatccacggg
gtgcccgcagactgtgctcgaaaggagaccaactacgtgctcaacaatggcttcaacccc
cgctgggggcagaccctgcagttccagctgcgggctccagagctggtcctggtccggttc
gtggtagaagattatgacaccacctcccccaatgactttgtgggccagtttacactgcct
ctcaacagcctgaagcaagggtaccgccacatccacctgctttccaaggacggggcctca
ctgtcaccagccacactcttcgtccacatccgcatccagcgcttctga

DBGET integrated database retrieval system