KEGG   Felis catus (domestic cat): 101086862Help
Entry
101086862         CDS       T02385                                 

Gene name
RPTOR
Definition
(RefSeq) regulatory associated protein of MTOR, complex 1
  KO
K07204  
regulatory associated protein of mTOR
Organism
fca  Felis catus (domestic cat)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
AMPK signaling pathway
Longevity regulating pathway
Longevity regulating pathway - multiple species
Insulin signaling pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101086862 (RPTOR)
   04152 AMPK signaling pathway
    101086862 (RPTOR)
   04150 mTOR signaling pathway
    101086862 (RPTOR)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101086862 (RPTOR)
  Aging
   04211 Longevity regulating pathway - mammal
    101086862 (RPTOR)
   04213 Longevity regulating pathway - multiple species
    101086862 (RPTOR)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101086862 (RPTOR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 1335 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGGSPPTSSASSSSLTNDVAKQPVGRD
LPAGRPGAPGPAGVQYTPHSQQFPRTRKMFDKGPDQTTDDADDAAGHRSFVSATTQTGFC
DWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTHVRQQARQLIQKGIARLDDQIFLN
RNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYLNGQD
CSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETGLLMS
SGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRRMALS
ECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGLTALD
IHPQANLIACGSMNQFTAIYSGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHLAVGS
NDYYISVYSVEKRAR
NT seq 4008 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcccctcttctgggactcggggaggaagatgaggccgac
ctcacagactggaacctgcccttggcttttatgaaaaagaggcactgtgagaaaatcgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgtcggtgtggaccctccagacgtggtgaagaccacccct
tgtgctcgtttagaatgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccacgggcccggtacaag
cagagcctcgacccgaccgtggatgaggtgaaaaagctctgcacgtctttacgccgaaac
gccaaggaggagcgggtcctcttccactacaacggccacggggtgcccaggcccaccgtg
aacggggagatctgggtcttcaacaagaactacacgcagtacatccctctgtctatctat
gacctgcagacgtggatgggcagcccgtcaatattcgtctacgactgctccaacgccggc
ttgatcgtcaagtccttcaaacagttcgccctgcagagggagcaggagctggaggttgct
gccattaacccgaaccacccgctcgcgcagatgcccctgcccccgtccatgaaaaactgc
attcagctggcagcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcctgcctcaccacccccatcaaaatcgccctgcgctggttttgcatg
cagaagtgcgtgagtctggtgcccggggtcacactggatttaatagaaaagatccccggc
cggctgaatgaccggaggacccctctgggagagctgaactggatcttcacagccatcaca
gacaccatcgcctggaacgtgctgcctcgggatctcttccaaaagctcttcagacaggac
ctgctggtggcgagtctgtttcgaaattttctgctggcagaaaggatcatgaggtcctac
aactgcactcccgtcagcagcccgcgcctgccccccacgtacatgcacgcgatgtggcaa
gcctgggacctggccgtcgacatctgcctctctcagctgcccaccatcattgaggaaggc
acggcgtttcggcacagtccgttctttgctgagcagctgaccgcgttccaggtgtggctc
accatgggcgtggagaacaggagcccgcccgagcaacttcccatcgttctgcaggtgctg
ttgagtcaggtgcaccggctgagagccctggatctgctggggcgcttcctggacctgggc
ccctgggcggtgagcctggccttgtctgtgggcatcttcccctacgtgctgaagctgctg
cagagctccgcccgagagctgcggcccctcctggttttcatctgggccaagatcctggcc
gtggacagttcgtgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcg
gtcctggcggacccgtacatgccagctgagcatcggaccatgacggctttcatcctggct
gtgatcgtgaacagttacaacacaggacaggaagcctgcttgcagggaaatctgatcgcc
atctgcctggagcagctcaacgacccccacccgctgctgcgccagtgggtggccatctgc
ctggggcgcatctggcagaactttgactcggccaggtggtgcggcgtgagggacagcgca
cacgagaagctctacagcctcctctccgaccccatccctgaggtgcgctgcgcggcggtc
ttcgctctcggcacgtttgtgggcaactcggcggagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaacgacgggagccccgtggtccgc
aaggaactggtggtggctctgagtcatcttgtcgtccagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaggaggagaagaattacccgttgccttctccagcgaccaca
gaggggggtagcttgaccccggtgcgggacagcccgtgcacccccagactccgctccgtg
agctcgtacggaaacattcgcgccgtcaccaccgccagaagcttgaacaaatctctgcag
aacctgagcttgacagaagagtcgggcagctcggtggccttctcccccggaaacttgagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgccgagtcagctcctactccgccctcaactccctcatc
ggagtctccttcaacagtgtttacactcagatttggagagtgttactgcatctggctgcg
gatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgcctacaag
gccacagtgaacgcccggccccagcgtatcctcaccacgtcctcactcacccagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggcggggggctcccccccgacg
tccagcgccagcagctccagcctgaccaacgacgtggccaagcagccagtcggccgagac
ctgcccgcgggccgccccggcgcccctggccccgcgggggtgcagtacacgccccactcc
cagcagttcccccgcacgcggaagatgttcgacaagggcccagaccagaccacagacgat
gcagatgatgctgccggacacagaagcttcgtctcagccacgacgcagacgggcttctgc
gactggagtgcccggtactttgcccagcccgtcatgaagatcccggaggaacacgacctg
gagagtcagatccgcaaggagcgcgagtggcgatttctccgcaacacccacgtcaggcag
caggcgcggcagctcatccagaagggtatcgcaagactggacgaccagatattcctgaac
aggaaccccggtgtcccctccgtggtcaagttccaccccttcacgccgtgtgtggccgtg
gctgataaagacagcatctgtttttgggactgggagaaaggggagaagctggattacttc
cacaacggaaaccctcggtataccagggtcaccgccatggagtacctgaatggccaggac
tgctcgctgctgctcacggccacagatgacggcgccatcagagtctggaagaactttgcg
gatttggagaagaacccagagatggtgactgcttggcaggggctctcggacatgctgccc
accaccagaggagccgggatggtggtagactgggagcaggagactggcctcctcatgagc
tcgggggacgtgcggatcgtccgaatctgggacacggaccgcgagatgaaagtacaggac
atccccacgggcgctgacagctgcgtgacaagcctgtcctgcgactcccaccgctccctc
atcgtggctggcctcggcgacggctccatccgcgtttacgaccggaggatggcgctcagt
gaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaaggcctacctccag
aagcaccccgagggccacatcatgagcgtgagtgtcaacggagacgtgcgcttcttcgat
cctcggatgccggagtccgtgaacgtccttcagatcgtgaaggggctcacggccctcgac
atccacccccaggcaaaccttatcgcctgcggctccatgaaccagttcacggccatctac
agcgggaacggggagctcatcaacaacatcaaatactacgacgggtttatgggccagcgc
gtcggggccatcagctgcctggccttccacccgcactggcctcacctggccgtgggcagc
aacgactactacatctccgtgtactcggtggagaagcgggccagatag

DBGET integrated database retrieval system