KEGG   Felis catus (domestic cat): 101086862Help
Entry
101086862         CDS       T02385                                 

Gene name
RPTOR
Definition
regulatory associated protein of MTOR, complex 1
Orthology
K07204  
regulatory associated protein of mTOR
Organism
fca  Felis catus (domestic cat)
Pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
MicroRNAs in cancer
Class
Environmental Information Processing; Signal transduction; PI3K-Akt signaling pathway [PATH:fca04151]
Environmental Information Processing; Signal transduction; mTOR signaling pathway [PATH:fca04150]
Organismal Systems; Endocrine system; Insulin signaling pathway [PATH:fca04910]
Human Diseases; Cancers; MicroRNAs in cancer [PATH:fca05206]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 1339 aa AA seqDB search
MESEMLQSPLLGLGEEDEADLTDWNLPLAFMKKRHCEKIEGSKSLAQSWRMKDRMKTVSV
ALVLCLNVGVDPPDVVKTTPCARLECWIDPLSMGPQKALETIGANLQKQYENWQPRARYK
QSLDPTVDEVKKLCTSLRRNAKEERVLFHYNGHGVPRPTVNGEIWVFNKNYTQYIPLSIY
DLQTWMGSPSIFVYDCSNAGLIVKSFKQFALQREQELEVAAINPNHPLAQMPLPPSMKNC
IQLAACEANELLPMIPDLPADLFTSCLTTPIKIALRWFCMQKCVSLVPGVTLDLIEKIPG
RLNDRRTPLGELNWIFTAITDTIAWNVLPRDLFQKLFRQDLLVASLFRNFLLAERIMRSY
NCTPVSSPRLPPTYMHAMWQAWDLAVDICLSQLPTIIEEGTAFRHSPFFAEQLTAFQVWL
TMGVENRSPPEQLPIVLQVLLSQVHRLRALDLLGRFLDLGPWAVSLALSVGIFPYVLKLL
QSSARELRPLLVFIWAKILAVDSSCQADLVKDNGHKYFLSVLADPYMPAEHRTMTAFILA
VIVNSYNTGQEACLQGNLIAICLEQLNDPHPLLRQWVAICLGRIWQNFDSARWCGVRDSA
HEKLYSLLSDPIPEVRCAAVFALGTFVGNSAERTDHSTTIDHNVAMMLAQLINDGSPVVR
KELVVALSHLVVQYESNFCTVALQFMEEEKNYPLPSPATTEGGSLTPVRDSPCTPRLRSV
SSYGNIRAVTTARSLNKSLQNLSLTEESGSSVAFSPGNLSTSSSASSTLGSPENEEYILS
FETIDKMRRVSSYSALNSLIGVSFNSVYTQIWRVLLHLAADPYPDVSDLAMKVLNSIAYK
ATVNARPQRILTTSSLTQSAPASPTNKGIHIHQAGXVARASPPTSSASSSSLTNDVAKQP
VGRDLPAGRPGAPGPAGVQYTPHSQQFPRTRKMFDKGPDQTTDDADDAAGHRSFVSATTQ
TGFCDWSARYFAQPVMKIPEEHDLESQIRKEREWRFLRNTHVRQQARQLIQKGIARLDDQ
IFLNRNPGVPSVVKFHPFTPCVAVADKDSICFWDWEKGEKLDYFHNGNPRYTRVTAMEYL
NGQDCSLLLTATDDGAIRVWKNFADLEKNPEMVTAWQGLSDMLPTTRGAGMVVDWEQETG
LLMSSGDVRIVRIWDTDREMKVQDIPTGADSCVTSLSCDSHRSLIVAGLGDGSIRVYDRR
MALSECRVMTYREHTAWVVKAYLQKHPEGHIMSVSVNGDVRFFDPRMPESVNVLQIVKGL
TALDIHPQANLIACGSMNQFTAIYSGNGELINNIKYYDGFMGQRVGAISCLAFHPHWPHL
AVGSNDYYISVYSVEKRAR
NT seq 4020 nt NT seq  +upstreamnt  +downstreamnt
atggagtccgagatgctgcagtcccctcttctgggactcggggaggaagatgaggccgac
ctcacagactggaacctgcccttggcttttatgaaaaagaggcactgtgagaaaatcgaa
ggctccaaatccttagctcagagctggaggatgaaggatcggatgaagacagtcagtgtt
gccttagttttgtgcctgaatgtcggtgtggaccctccagacgtggtgaagaccacccct
tgtgctcgtttagaatgctggatcgatcctctgtcgatggggcctcagaaagctctggaa
accatcggtgcaaatttacagaagcagtacgagaactggcagccacgggcccggtacaag
cagagcctcgaccctaccgtggatgaggtgaaaaagctctgcacgtctttacgccgaaac
gccaaggaggagcgggtcctcttccactacaacggccacggggtgcccaggcccaccgtg
aacggggagatctgggtcttcaacaagaactacacgcagtacatccctctgtctatctat
gacctgcagacgtggatgggcagcccgtcaatattcgtctacgactgctccaacgccggc
ttgatcgtcaagtccttcaaacagttcgccctgcagagggagcaggagctggaggttgct
gccattaacccgaaccacccgctcgcgcagatgcccctgcccccgtccatgaaaaactgc
attcagctggcagcctgtgaggccaacgagctcctgcccatgatccccgacctcccggcc
gacctgttcacgtcctgcctcaccacccccatcaaaatcgccctgcgctggttttgcatg
cagaagtgcgtgagtctggtgcccggggtcacactggatttaatagaaaagatccccggc
cggctgaatgaccggaggacccctctgggagagctgaactggatcttcacagccatcaca
gacaccatcgcctggaacgtgctgcctcgggatctcttccaaaagctcttcagacaggac
ctgctggtggcgagtctgtttcgaaattttctgctggcagaaaggatcatgaggtcctac
aactgcactcccgtcagcagcccgcgcctgccccccacgtacatgcacgcgatgtggcaa
gcctgggacctggccgtcgacatctgcctctctcagctgcccaccatcattgaggaaggc
acggcgtttcggcacagtccgttctttgctgagcagctgaccgcgttccaggtgtggctc
accatgggcgtggagaacaggagcccgcccgagcaacttcccatcgttctgcaggtgctg
ttgagtcaggtgcaccggctgagagccctggatctgctggggcgcttcctggacctgggc
ccctgggcggtgagcctggccttgtctgtgggcatcttcccctacgtgctgaagctgctg
cagagctccgcccgagagctgcggcccctcctggttttcatctgggccaagatcctggcc
gtggacagttcgtgccaagctgacctggtgaaggacaacggtcacaaatacttcctgtcg
gtcctggcggacccgtacatgccagctgagcatcggaccatgacggctttcatcctggct
gtgatcgtgaacagttacaacacaggacaggaagcctgcttgcagggaaatctgatcgcc
atctgcctggagcagctcaacgacccccacccgctgctgcgccagtgggtggccatctgc
ctggggcgcatctggcagaactttgactcggccaggtggtgcggcgtgagggacagcgca
cacgagaagctctacagcctcctctccgaccccatccctgaggtgcgctgcgcggcggtc
ttcgctctcggcacgtttgtgggcaactcggcggagaggaccgaccactcgaccaccatc
gaccacaacgtggccatgatgctggcccagctgatcaacgacgggagccccgtggtccgc
aaggaactggtggtggctctgagtcatcttgtcgtccagtacgaaagcaatttctgcacc
gtggccttgcagttcatggaggaggagaagaattacccgttgccttctccagcgaccaca
gaggggggtagcttgaccccggtgcgggacagcccgtgcacccccagactccgctccgtg
agctcgtacggaaacattcgcgccgtcaccaccgccagaagcttgaacaaatctctgcag
aacctgagcttgacagaagagtcgggcagctcggtggccttctcccccggaaacttgagc
accagcagcagcgccagcagcaccctgggcagccccgagaacgaggagtacatcctgtcc
ttcgagaccatcgacaagatgcgccgagtcagctcctactccgccctcaactccctcatc
ggagtctccttcaacagtgtttacactcagatttggagagtgttactgcatctggctgcg
gatccctatccagacgtttccgacttggccatgaaggtgctcaacagcattgcctacaag
gccacagtgaacgcccggccccagcgtatcctcaccacgtcctcactcacccagtcggcg
cccgccagccccaccaacaagggcatccacatccaccaggcggggtaagtggcccgggcc
tcccccccgacgtccagcgccagcagctccagcctgaccaacgacgtggccaagcagcca
gtcggccgagacctgcccgcgggccgccccggcgcccctggccccgcgggggtgcagtac
acgccccactcccagcagttcccccgcacgcggaagatgttcgacaagggcccagaccag
accacagacgatgcagatgacgctgccggacacagaagcttcgtctcagccacgacgcag
acgggcttctgcgactggagtgcccggtactttgcccagcccgtcatgaagatcccggag
gaacacgacctggagagtcagatccgcaaggagcgcgagtggcgatttctccgcaacacc
cacgtcaggcagcaggcgcggcagctcatccagaagggtatcgcaagactggacgaccag
atattcctgaacaggaaccccggtgtcccctccgtggtcaagttccaccccttcacgccg
tgtgtggccgtggctgataaagacagcatctgtttttgggactgggagaaaggggagaag
ctggattacttccacaacggaaaccctcggtataccagggtcaccgccatggagtacctg
aatggccaggactgctcgctgctgctcacggccacagatgacggcgccatcagagtctgg
aagaactttgcggatttggagaagaacccagagatggtgactgcttggcaggggctctcg
gacatgctgcccaccaccagaggagccgggatggtggtagactgggagcaggagactggc
ctcctcatgagctcgggggacgtgcggatcgtccgaatctgggacacggaccgcgagatg
aaagtacaggacatccccacgggcgctgacagctgcgtgacaagcctgtcctgcgactcc
caccgctccctcatcgtggctggcctcggcgacggctccatccgcgtttacgaccggagg
atggcgctcagtgaatgccgcgtcatgacgtaccgggagcacacggcctgggtggtgaag
gcctacctccagaagcaccccgagggccacatcatgagcgtgagtgtcaacggagacgtg
cgcttcttcgatcctcggatgccggagtccgtgaacgtccttcagatcgtgaaggggctc
acggccctcgacatccacccccaggcaaaccttatcgcctgcggctccatgaaccagttc
acggccatctacagcgggaacggggagctcatcaacaacatcaaatactacgacgggttt
atgggccagcgcgtcggggccatcagctgcctggccttccacccgcactggcctcacctg
gccgtgggcagcaacgactactacatctccgtgtactcggtggagaagcgggccagatag

DBGET integrated database retrieval system