KEGG   Felis catus (domestic cat): 101086901Help
Entry
101086901         CDS       T02385                                 

Definition
histone-lysine N-methyltransferase NSD3-like
Orthology
K11425  
histone-lysine N-methyltransferase NSD3 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B1
AA seq 645 aa AA seqDB search
MDFSFSFMQGIMGNTIQQPPQLIDSANIRQEDAFDNNSDIVEDGGQTPYEATLQQGFQYP
PTTEDLPPLTNGYPPSISMYETQTKYQSYNQYPNGSANGFGAVRNFSPTDYYHSEIPNTR
PHEILEKPSPPQPPPPPSVPQTVIPKKTGSPEIKLKITKTIQNGRELFESSLCGDLLNEV
QASEHTKSKHESRKEKRKKSNKHDSSRSEERKSHKIPKLEPEEQNRPNERIDTVSEKPRD
DPVLKEEPPVQPILSSVPTTEVSAGVKFQVGDLVWSKVGTYPWWPCMVSSDPQLEVHTKI
NTRGAREYHVQFFSNQPERAWVHEKRVREYKGHKQYEELLAEATKQASNHSEKQKIRKPR
PQRERAQWDIGIAHAEKALKMTREERIEQYTFIYIDKQPEEALSQAKKNVASKAEVKKTR
RPRSVLNTQPEQTDAGEVASSPSSTEIRRQSQRRHTSVEEEEPPPVKIAWKTAAARKSLP
ASITMHKGSLDLQKCNMSPVVKIEQVFALQNATGDGKFIDQFVYSTKGIGNKTEISVRGQ
DRLIISTPNQRSEKATQNISSPEATSGPTGSVEKKQQRRSIRTRSESEKSTEVVPKKKIK
KEQVETVPQATVKTGLQKGSADRGVQGSVRFSDSSVSAAIEETVD
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggatttctctttctctttcatgcaagggatcatgggaaacacaattcagcaaccacct
caactcattgactccgccaacatccgtcaggaggatgcctttgataacaacagtgacatt
gttgaagatggtggccagacaccatatgaagctaccttgcagcaaggctttcagtatcca
cctacaacagaagatcttcctccactcacaaatggctatccaccatcgatcagcatgtat
gaaactcaaaccaaataccagtcatataatcagtatcccaatgggtcagccaatggcttt
ggtgcagttagaaactttagccccactgactattaccattcagaaattccaaacacaaga
ccacatgaaattctggaaaaaccttctcctccacagccaccacctcctccttcggtacca
caaactgtgattccaaagaagactggctcacctgaaattaaactaaaaataaccaaaact
atccagaatggcagggaattgtttgagtcttccctttgtggagaccttttaaatgaagta
caggcaagtgagcacacaaaatcaaagcatgaaagcagaaaggaaaagaggaaaaaaagc
aacaagcatgactcatctagatctgaagagcgcaagtcacacaaaatccccaaattagaa
ccagaggaacaaaatagaccaaatgagaggattgacactgtgtcagaaaaaccaagagac
gatccagtactaaaagaggaacccccggttcagccaatattatcttctgttccaacaaca
gaagtgtcagctggtgttaagttccaggttggcgatcttgtttggtctaaggtgggaacc
tatccttggtggccttgcatggtttcaagtgatccccagctcgaggttcataccaaaatt
aacacaagaggtgcccgggaatatcacgtccaattttttagcaaccagccagagagggcc
tgggttcatgaaaagcgagtacgagagtataagggtcataaacagtatgaagaattattg
gctgaagcaaccaaacaagccagcaatcactctgagaaacaaaagattcggaaaccccga
cctcagagagaacgtgctcagtgggatattggcattgcccatgcagagaaagcattgaaa
atgacccgagaggaaagaatagaacagtatacttttatctatattgataaacagcccgag
gaggctttatcccaagcaaaaaagaacgttgcctccaaagccgaagttaagaaaacacga
agaccaaggtcagtgctgaatactcagccagaacagaccgatgcaggtgaggtggcctcc
tcaccatcaagtactgaaattcggagacagagccagaggcggcacacaagtgtggaagag
gaagaaccacctcctgttaaaatagcctggaaaacggctgcagcgaggaaatctttacca
gcttccattacaatgcacaaagggagcctggatttgcagaagtgtaacatgtctccagtt
gtgaaaattgaacaagtgtttgctcttcagaatgctacaggagatgggaaatttatcgat
caatttgtttattcaacgaagggaattggtaacaaaacggaaataagtgtcaggggacaa
gacagacttatcatttccacaccaaaccagagaagtgaaaaggcaactcagaatatatca
tctcctgaagcaacatctggtcctacaggctcagtagaaaagaagcaacagagaagatca
attagaactcgttctgaatcagagaaatccactgaggttgtgccaaagaagaagatcaaa
aaggagcaggttgaaacagttcctcaggctacagtgaagactggattacagaaagggtcg
gcggaccggggagtgcagggctctgtcagattcagtgacagctccgtctccgcagcgatt
gaggaaactgtggactga

DBGET integrated database retrieval system