KEGG   Felis catus (domestic cat): 101087003Help
Entry
101087003         CDS       T02385                                 

Gene name
GRIA4
Definition
(RefSeq) LOW QUALITY PROTEIN: glutamate receptor 4
  KO
K05200  glutamate receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
fca04024  cAMP signaling pathway
fca04080  Neuroactive ligand-receptor interaction
fca04713  Circadian entrainment
fca04723  Retrograde endocannabinoid signaling
fca04724  Glutamatergic synapse
fca04728  Dopaminergic synapse
fca05031  Amphetamine addiction
fca05033  Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    101087003 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101087003 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    101087003 (GRIA4)
   04728 Dopaminergic synapse
    101087003 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    101087003 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    101087003 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    101087003 (GRIA4)
   05033 Nicotine addiction
    101087003 (GRIA4)
Ion channels [BR:fca04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   101087003 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ANF_receptor Lig_chan Lig_chan-Glu_bd SBP_bac_3 Peripla_BP_6
Motif
Other DBs
NCBI-GeneID: 101087003
NCBI-ProteinID: XP_023094824
Ensembl: ENSFCAG00000015605
Position
D1
AA seq 902 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRXYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMESPYVMYKKNHEMFEGNDKYEGYCVDLASEIAKHIGIKYKIAIVPDGKYGARDADTK
IWNGMVGELVYGKAEIAIAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKSKPGVFSFL
DPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHTEEPEDGKEGPSDQPPNEFGIFNSLW
FSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVERMVSPIESAED
LAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWTYMRSAEPSVFTRTTAEGVARVRKSKG
KFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSSLRNAVNLAVLKLNEQGL
LDKLKNKWWYDKGECGSGGGDSKDKTSALSLSNVAGVFYILVGGLGLAMLVALIEFCYKS
RAEAKRMKLTFSEAIRNKARLSITGSVGENGRVLTPDCPKAVHTGTTIRQSSGLAVIASD
LP
NT seq 2709 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggtctcttcatccgaaacacagatcaggaa
tacacagcctttcgattagcaatctttcttcacaacactagccccaatgcgtccgaagct
ccttttaatctggtacctcatgtggacaacatcgagacagccaacagttttgccgtgaca
aatgctttctgttcccagtattctagaggagtgttcgccattttcggactctacgataag
aggtcggtacacaccttgacctcgttctgcagcgccttgcacatctccctcatcacaccg
agtttccccacggagggggagagccagtttgtgctgcagctcagaccgtccttgcggggc
gcgctcctgagtctgctggaccactacgaatggaactgtttcgtcttcctgtacgacacg
gacaggtgatactcaatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagacgacaagagaagaaatttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtgagtgttgggaagcatgttaagggttaccactacatcattgca
aacttgggattcaaggatatttctctggagagatttatccatggtggagccaatgttaca
ggattccagctggttgattttaatacacctatggtaaccaaactaatggatcgctggaag
aaactagaccagagagagtatccaggatctgagactcctccaaagtatacgtctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaaatcttaggaggcagaaaatt
gatatttcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaaggactgacaggaaat
gttcagtttgaccactatggacgtagggtcaattacacaatggatgtgtttgagctgaag
agcacagggcctagaaaggttggctactggaatgatatggataaattagtcttgattcag
gacgtgcccactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatggaatccccatatgttatgtacaagaaaaatcacgaaatgtttgaaggaaat
gacaagtatgaaggatactgtgtagatttggcatctgaaattgcaaaacatattggtatc
aagtataaaattgccattgtccctgatggaaaatatggagcgagggacgcagacacaaaa
atctggaatgggatggtaggagaacttgtttatgggaaagcagagattgctatcgcccct
ctgacaatcactttggtccgagaggaggtcattgacttctctaagcccttcatgagtttg
ggcatatctatcatgatcaaaaagcctcagaaatccaaaccaggagtgttttccttcttg
gatcctctggcctatgagatttggatgtgcatagtctttgcctacattggtgtcagcgtg
gtcttattcctagttagcaggttcagtccgtacgagtggcacacagaagagccggaggat
ggaaaggaaggacccagcgaccagcctcccaatgagtttggcatctttaacagcctctgg
ttttccctgggtgccttcatgcagcaaggatgtgacatttcacccagatccctctcaggt
cggattgttggaggtgtctggtggttcttcacgctcatcattatatcatcttataccgct
aacctcgctgctttcctgacggtagaacgaatggtctcccccatagaaagtgcggaagac
ctggccaaacaaacagaaattgcctatggaacattggattcagggtcaacaaaagaattc
ttcagaagatcaaaaatagcagtgtacgaaaagatgtggacctacatgcgatcggcagag
ccgtccgtgttcacgaggactacagctgagggagtggctcgtgtccgcaaatccaagggc
aaatttgcgttcctcctggagtccactatgaacgagtacattgagcagcgaaagccgtgt
gacacgatgaaagtgggaggaaatctggattcgaaaggctatggagtagcaacgcccaag
ggttcctcattaagaaatgctgttaacctggcagttttaaaactgaatgaacaaggcctg
ttggacaaattgaaaaacaaatggtggtacgacaaaggagagtgtggcagcgggggcggt
gactccaaggacaagacgagcgccttgagcctgagcaacgtcgcaggcgttttctacatt
ctggtcggcggcttgggcttggcgatgctggtggctttgatagagttctgttacaagtcc
agggcagaagcgaagagaatgaagctgaccttttctgaagccataagaaacaaagccaga
ttatccatcactgggagcgtgggtgagaacggccgcgttttgacgcccgactgccccaag
gcggtacacacgggaactacgattagacagagttcgggattggctgtcattgcatcggac
ctaccatga

DBGET integrated database retrieval system