KEGG   Felis catus (domestic cat): 101087003Help
Entry
101087003         CDS       T02385                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
cAMP signaling pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04024 cAMP signaling pathway
    101087003 (GRIA4)
  Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    101087003 (GRIA4)
 Organismal Systems
  Nervous system
   04724 Glutamatergic synapse
    101087003 (GRIA4)
   04728 Dopaminergic synapse
    101087003 (GRIA4)
   04723 Retrograde endocannabinoid signaling
    101087003 (GRIA4)
  Environmental adaptation
   04713 Circadian entrainment
    101087003 (GRIA4)
 Human Diseases
  Substance dependence
   05031 Amphetamine addiction
    101087003 (GRIA4)
   05033 Nicotine addiction
    101087003 (GRIA4)
Ion channels [BR:fca04040]
 Glutamate-gated cation channels
  Glutamate (ionotropic), non-NMDA
   101087003 (GRIA4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D1
AA seq 433 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMPLMKNPILRN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggtctcttcatccgaaacacagatcaggaa
tacacagcctttcgattagcaatctttcttcacaacactagccccaatgcgtccgaagct
ccttttaatctggtacctcatgtggacaacatcgagacagccaacagttttgccgtgaca
aatgctttctgttcccagtattctagaggagtgttcgccattttcggactctacgataag
aggtcggtacacaccttgacctcgttctgcagcgccttgcacatctccctcatcacaccg
agtttccccacggagggggagagccagtttgtgctgcagctcagaccgtccttgcggggc
gcgctcctgagtctgctggaccactacgaatggaactgtttcgtcttcctgtacgacacg
gacaggggatactcaatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagacgacaagagaagaaatttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtgagtgttgggaagcatgttaagggttaccactacatcattgca
aacttgggattcaaggatatttctctggagagatttatccatggtggagccaatgttaca
ggattccagctggttgattttaatacacctatggtaaccaaactaatggatcgctggaag
aaactagaccagagagagtatccaggatctgagactcctccaaagtatacgtctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaaatcttaggaggcagaaaatt
gatatttcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaaggactgacaggaaat
gttcagtttgaccactatggacgtagggtcaattacacaatggatgtgtttgagctgaag
agcacagggcctagaaaggttggctactggaatgatatggataaattagtcttgattcag
gacgtgcccactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatgcctctgatgaagaatcctattttaagaaattga

DBGET integrated database retrieval system