KEGG   Felis catus (domestic cat): 101087003Help
Entry
101087003         CDS       T02385                                 

Gene name
GRIA4
Definition
glutamate receptor, ionotropic, AMPA 4
Orthology
K05200  
glutamate receptor 4
Organism
fca  Felis catus (domestic cat)
Pathway
Neuroactive ligand-receptor interaction
Circadian entrainment
Retrograde endocannabinoid signaling
Glutamatergic synapse
Dopaminergic synapse
Amphetamine addiction
Nicotine addiction
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:fca04080]
Organismal Systems; Nervous system; Glutamatergic synapse [PATH:fca04724]
Organismal Systems; Nervous system; Dopaminergic synapse [PATH:fca04728]
Organismal Systems; Nervous system; Retrograde endocannabinoid signaling [PATH:fca04723]
Organismal Systems; Environmental adaptation; Circadian entrainment [PATH:fca04713]
Human Diseases; Substance dependence; Amphetamine addiction [PATH:fca05031]
Human Diseases; Substance dependence; Nicotine addiction [PATH:fca05033]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D1
AA seq 433 aa AA seqDB search
MRIICRQIVLLFSGFWGLAMGAFPSSVQIGGLFIRNTDQEYTAFRLAIFLHNTSPNASEA
PFNLVPHVDNIETANSFAVTNAFCSQYSRGVFAIFGLYDKRSVHTLTSFCSALHISLITP
SFPTEGESQFVLQLRPSLRGALLSLLDHYEWNCFVFLYDTDRGYSILQAIMEKAGQNGWH
VSAICVENFNDVSYRQLLEELDRRQEKKFVIDCEIERLQNILEQIVSVGKHVKGYHYIIA
NLGFKDISLERFIHGGANVTGFQLVDFNTPMVTKLMDRWKKLDQREYPGSETPPKYTSAL
TYDGVLVMAETFRNLRRQKIDISRRGNAGDCLANPAAPWGQGIDMERTLKQVRIQGLTGN
VQFDHYGRRVNYTMDVFELKSTGPRKVGYWNDMDKLVLIQDVPTLGNDTAAIENRTVVVT
TIMPLMKNPILRN
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaggattatttgcaggcagattgtcttgttgttttctggattttggggactcgccatg
ggagcctttccgagcagcgtgcagataggtggtctcttcatccgaaacacagatcaggaa
tacacagcctttcgattagcaatctttcttcacaacactagccccaatgcgtccgaagct
ccttttaatctggtacctcatgtggacaacatcgagacagccaacagttttgccgtgaca
aatgctttctgttcccagtattctagaggagtgttcgccattttcggactctacgataag
aggtcggtacacaccttgacctcgttctgcagcgccttgcacatctccctcatcacaccg
agtttccccacggagggggagagccagtttgtgctgcagctcagaccgtccttgcggggc
gcgctcctgagtctgctggaccactacgaatggaactgtttcgtcttcctgtacgacacg
gacaggggatactcaatacttcaagctattatggaaaaagcaggacaaaatggttggcat
gtcagcgctatatgtgtggaaaattttaatgatgtcagctataggcaacttctagaagaa
cttgatagacgacaagagaagaaatttgtaatagactgtgagatagagagacttcaaaac
atattagaacagattgtgagtgttgggaagcatgttaagggttaccactacatcattgca
aacttgggattcaaggatatttctctggagagatttatccatggtggagccaatgttaca
ggattccagctggttgattttaatacacctatggtaaccaaactaatggatcgctggaag
aaactagaccagagagagtatccaggatctgagactcctccaaagtatacgtctgctctg
acttatgatggagtccttgtgatggctgaaactttccgaaatcttaggaggcagaaaatt
gatatttcaaggagaggaaatgctggggattgtctggcaaatcctgctgctccatggggc
cagggaattgacatggagaggacactcaaacaggttcgaattcaaggactgacaggaaat
gttcagtttgaccactatggacgtagggtcaattacacaatggatgtgtttgagctgaag
agcacagggcctagaaaggttggctactggaatgatatggataaattagtcttgattcag
gacgtgcccactcttggcaatgacacagcagctattgagaacagaacagtggttgtaacc
acaattatgcctctgatgaagaatcctattttaagaaattga

DBGET integrated database retrieval system