KEGG   Felis catus (domestic cat): 101087013Help
Entry
101087013         CDS       T02385                                 

Gene name
SYK
Definition
(RefSeq) tyrosine-protein kinase SYK isoform X3
  KO
K05855  spleen tyrosine kinase [EC:2.7.10.2]
Organism
fca  Felis catus (domestic cat)
Pathway
fca04064  NF-kappa B signaling pathway
fca04072  Phospholipase D signaling pathway
fca04151  PI3K-Akt signaling pathway
fca04380  Osteoclast differentiation
fca04611  Platelet activation
fca04625  C-type lectin receptor signaling pathway
fca04650  Natural killer cell mediated cytotoxicity
fca04662  B cell receptor signaling pathway
fca04664  Fc epsilon RI signaling pathway
fca04666  Fc gamma R-mediated phagocytosis
fca05152  Tuberculosis
fca05167  Kaposi's sarcoma-associated herpesvirus infection
fca05169  Epstein-Barr virus infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04064 NF-kappa B signaling pathway
    101087013 (SYK)
   04072 Phospholipase D signaling pathway
    101087013 (SYK)
   04151 PI3K-Akt signaling pathway
    101087013 (SYK)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101087013 (SYK)
   04625 C-type lectin receptor signaling pathway
    101087013 (SYK)
   04650 Natural killer cell mediated cytotoxicity
    101087013 (SYK)
   04662 B cell receptor signaling pathway
    101087013 (SYK)
   04664 Fc epsilon RI signaling pathway
    101087013 (SYK)
   04666 Fc gamma R-mediated phagocytosis
    101087013 (SYK)
  Development
   04380 Osteoclast differentiation
    101087013 (SYK)
 Human Diseases
  Cancers
   05203 Viral carcinogenesis
    101087013 (SYK)
  Infectious diseases
   05152 Tuberculosis
    101087013 (SYK)
   05167 Kaposi's sarcoma-associated herpesvirus infection
    101087013 (SYK)
   05169 Epstein-Barr virus infection
    101087013 (SYK)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.2  non-specific protein-tyrosine kinase
     101087013 (SYK)
Protein kinases [BR:fca01001]
 Non-receptor tyrosine kinases
  SYK family
   101087013 (SYK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase_Tyr Pkinase Kdo Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101087013
NCBI-ProteinID: XP_019671258
Ensembl: ENSFCAG00000014214
Position
D4
AA seq 361 aa AA seqDB search
MVSGWNYLKNQIILLPKAWPQKGLHIPREPARERRDLQSVRAGPRALAHGQSLCLPDHPA
DAQREALPMDTEVYESPYADPEEIRPKEVYLDRKLLTLEDNELGSGNFGTVKKGYYQMKK
VVKTVAVKILKNEANDPALKDELLAEANVMQQLDNPYIVRMIGICEAESWMLVMEMAELG
PLNKYLQQNRHVKDKNIIELVHQVSMGMKYLEESNFVHRDLAARNVLLVTQHYAKISDFG
LSKALRADENYYKAQTHGKWPVKWYAPECINYYKFSSKSDVWSFGVLMWEAFSYGQKPYR
GMKGSEVSAMLEKGERMGCPTGCPREMYELMKLCWTYEVESRPGFAAVELRLRNYYYDVV
N
NT seq 1086 nt NT seq  +upstreamnt  +downstreamnt
atggtcagcgggtggaattatctcaagaatcaaatcatactccttcccaaagcctggcca
cagaaaggcctccacatcccaagggagccggccagagagcgccgtgaccttcaatccgta
cgagccggaccgcgggccctggcccacggacagagcttgtgtcttccggaccaccctgca
gacgcccagagagaggccttgcccatggacaccgaggtgtatgaaagcccgtatgcggac
cctgaggagatcaggcccaaggaagtctacctggaccgcaagctgctgaccctggaggac
aacgaactgggctctggtaacttcgggaccgtgaagaagggctactaccagatgaaaaaa
gtcgtgaaaacggtggctgtgaagattctgaagaacgaggctaacgaccccgctcttaaa
gatgagttattagcggaagccaatgtcatgcagcagctcgataacccttacatcgtgcgc
atgatcggcatctgtgaagccgagtcctggatgctggtgatggagatggcggaactgggt
ccgctcaacaagtatttacagcagaacaggcacgtcaaggataagaacatcatagagctg
gttcatcaggtttctatgggaatgaagtatctggaggagagcaattttgtgcacagggat
ctggcggcaagaaacgtcttgctggttactcaacactatgccaagatcagtgattttgga
ctttccaaagcgctccgtgctgatgaaaactactacaaggcccagacccacgggaagtgg
ccggtcaagtggtacgcccccgagtgcatcaactactacaagttctccagcaagagtgac
gtctggagcttcggcgtgttgatgtgggaggcgttctcctacgggcagaagccgtaccgg
ggcatgaagggaagcgaggtttcggccatgctggagaaaggagagagaatggggtgcccc
acggggtgtccgagggagatgtacgagctgatgaagctgtgctggacgtatgaggtggag
agcaggcccggattcgcagccgtggaactgcgtctacgcaattattactacgacgtggtc
aattaa

DBGET integrated database retrieval system