KEGG   Felis catus (domestic cat): 101087059Help
Entry
101087059         CDS       T02385                                 

Gene name
UGT2A2
Definition
UDP glucuronosyltransferase 2 family, polypeptide A2
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101087059 (UGT2A2)
   00053 Ascorbate and aldarate metabolism
    101087059 (UGT2A2)
   00500 Starch and sucrose metabolism
    101087059 (UGT2A2)
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101087059 (UGT2A2)
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101087059 (UGT2A2)
   00860 Porphyrin and chlorophyll metabolism
    101087059 (UGT2A2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101087059 (UGT2A2)
   00982 Drug metabolism - cytochrome P450
    101087059 (UGT2A2)
   00983 Drug metabolism - other enzymes
    101087059 (UGT2A2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101087059 (UGT2A2)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101087059 (UGT2A2)
Glycosyltransferases [BR:fca01003]
 Others
  Hydrophobic molecule
   101087059 (UGT2A2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B1
AA seq 528 aa AA seqDB search
MLNKNILLLCLQISLLGITLGGNVLIWPMEGSHWLNIKIIIDELIEKEHNVTVLVASGAL
FITPTSTPSLTFEIYKVAFGKERIEGLIKDFVLTWMEKRPSPSTIWRFYQDIAKVIKDFH
MISREICDGVLKNQKLMEKLKKSKFEVLISDPVFPCGDIVALKLGIPFMYSLRFSPASTV
EKHCGKVPYPPSYVPATLSELTDQMSFTDRIRNFISYSLQDYMFNTLWKSWDSYYSKALG
RPTTLCEVMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGE
DGIVVFSLGSMVRNLSDEKANLIASALAQIPQKVLWRYKGKKPATLGANTRLYDWIPQND
LLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINTMT
SEDLLNALRTVINESSYKENATRLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAH
DLTWFQYHSFDVIGFLLVCAATAIFLVTKCCLFSCQKLGKTGKKKKRE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaagaacattctgctgttgtgtctccagattagtctcctaggaatcactctt
ggtgggaatgttctgatttggccaatggaaggtagtcattggctgaacattaagatcatt
atagatgagttgattgaaaaagagcataatgtgactgttttagttgcctctggtgcactt
ttcatcacgccaacctcgaccccatctctgacatttgaaatatataaggtggcctttggc
aaagaaagaatagaaggactgatcaaggactttgttttgacatggatggaaaagaggcca
tctccttcaaccatttggagattctatcaagatatagccaaagtcatcaaggacttccac
atgatatctagagaaatctgtgatggtgttcttaaaaaccaaaagctgatggaaaagctg
aagaaaagcaaatttgaggtcctgatatcagatccagtatttccttgtggtgatatagta
gctttaaagctgggaattccatttatgtactccctcaggttttctccagcctcaacagtg
gaaaaacattgtgggaaggtaccataccctccttcctatgttcctgccactttatcagaa
ctcacggaccagatgtctttcactgacagaataagaaatttcatctcctacagtctacag
gactacatgtttaacactctttggaaatcatgggattcctactatagtaaagctttggga
agacccactacattatgtgaggttatggggaaagcagaaatttggctaatccggacatat
tgggattttgaatttcctcgtccatacttacctaactttgagtttgtaggagggttgcac
tgtaaacctgccaaaccattacctaaggaaatggaagaatttgtccaaagttcaggtgaa
gatggtattgtggtgttttctctggggtcaatggtcagaaacctctcagatgaaaaagcc
aatctcattgcctcagccctggcccagattccacaaaaggttttatggagatacaaagga
aagaaaccagccacattaggagccaatactcggctctatgattggataccccagaatgat
cttcttggtcatcccaaaacaaaagcttttatcactcatggtggaaccaatgggatctat
gaagctatttatcatggggttcctatggtgggagttcccatgtttgctgatcagcctgat
aatatcgctcacatgaaggccaaaggagcagctgtggaggtgaacataaacacaatgaca
agcgaagatctgctcaatgccttgagaacagtcattaatgaatcttcttataaagagaat
gctacaaggttatcaaggattcaacatgatcaacctgtaaagcccctagatcgagcagtc
ttctggatagagtttgtcatgcgtcacaaaggagccaagcacctgcgtccagctgcccat
gacctcacctggttccagtaccattctttcgatgtgattggtttcctgctggtctgtgca
gcaactgctatcttcttggtcacaaaatgttgtttgttttcttgccaaaaacttggtaaa
acaggaaagaagaaaaagagggaatag

DBGET integrated database retrieval system