KEGG   Felis catus (domestic cat): 101087059Help
Entry
101087059         CDS       T02385                                 

Gene name
UGT2A2
Definition
UDP glucuronosyltransferase 2 family, polypeptide A2
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:fca00040]
Metabolism; Carbohydrate metabolism; Ascorbate and aldarate metabolism [PATH:fca00053]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:fca00500]
Metabolism; Lipid metabolism; Steroid hormone biosynthesis [PATH:fca00140]
Metabolism; Metabolism of cofactors and vitamins; Retinol metabolism [PATH:fca00830]
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:fca00860]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:fca00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:fca00982]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - other enzymes [PATH:fca00983]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:fca05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
B1
AA seq 528 aa AA seqDB search
MLNKNILLLCLQISLLGITLGGNVLIWPMEGSHWLNIKIIIDELIEKEHNVTVLVASGAL
FITPTSTPSLTFEIYKVAFGKERIEGLIKDFVLTWMEKRPSPSTIWRFYQDIAKVIKDFH
MISREICDGVLKNQKLMEKLKKSKFEVLISDPVFPCGDIVALKLGIPFMYSLRFSPASTV
EKHCGKVPYPPSYVPATLSELTDQMSFTDRIRNFISYSLQDYMFNTLWKSWDSYYSKALG
RPTTLCEVMGKAEIWLIRTYWDFEFPRPYLPNFEFVGGLHCKPAKPLPKEMEEFVQSSGE
DGIVVFSLGSMVRNLSDEKANLIASALAQIPQKVLWRYKGKKPATLGANTRLYDWIPQND
LLGHPKTKAFITHGGTNGIYEAIYHGVPMVGVPMFADQPDNIAHMKAKGAAVEVNINTMT
SEDLLNALRTVINESSYKENATRLSRIQHDQPVKPLDRAVFWIEFVMRHKGAKHLRPAAH
DLTWFQYHSFDVIGFLLVCAATAIFLVTKCCLFSCQKLGKTGKKKKRE
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgttaaacaagaacattctgctgttgtgtctccagattagtctcctaggaatcactctt
ggtgggaatgttctgatttggccaatggaaggtagtcattggctgaacattaagatcatt
atagatgagttgattgaaaaagagcataatgtgactgttttagttgcctctggtgcactt
ttcatcacgccaacctcgaccccatctctgacatttgaaatatataaggtggcctttggc
aaagaaagaatagaaggactgatcaaggactttgttttgacatggatggaaaagaggcca
tctccttcaaccatttggagattctatcaagatatagccaaagtcatcaaggacttccac
atgatatctagagaaatctgtgatggtgttcttaaaaaccaaaagctgatggaaaagctg
aagaaaagcaaatttgaggtcctgatatcagatccagtatttccttgtggtgatatagta
gctttaaagctgggaattccatttatgtactccctcaggttttctccagcctcaacagtg
gaaaaacattgtgggaaggtaccataccctccttcctatgttcctgccactttatcagaa
ctcacggaccagatgtctttcactgacagaataagaaatttcatctcctacagtctacag
gactacatgtttaacactctttggaaatcatgggattcctactatagtaaagctttggga
agacccactacattatgtgaggttatggggaaagcagaaatttggctaatccggacatat
tgggattttgaatttcctcgtccatacttacctaactttgagtttgtaggagggttgcac
tgtaaacctgccaaaccattacctaaggaaatggaagaatttgtccaaagttcaggtgaa
gatggtattgtggtgttttctctggggtcaatggtcagaaacctctcagatgaaaaagcc
aatctcattgcctcagccctggcccagattccacaaaaggttttatggagatacaaagga
aagaaaccagccacattaggagccaatactcggctctatgattggataccccagaatgat
cttcttggtcatcccaaaacaaaagcttttatcactcatggtggaaccaatgggatctat
gaagctatttatcatggggttcctatggtgggagttcccatgtttgctgatcagcctgat
aatatcgctcacatgaaggccaaaggagcagctgtggaggtgaacataaacacaatgaca
agcgaagatctgctcaatgccttgagaacagtcattaatgaatcttcttataaagagaat
gctacaaggttatcaaggattcaacatgatcaacctgtaaagcccctagatcgagcagtc
ttctggatagagtttgtcatgcgtcacaaaggagccaagcacctgcgtccagctgcccat
gacctcacctggttccagtaccattctttcgatgtgattggtttcctgctggtctgtgca
gcaactgctatcttcttggtcacaaaatgttgtttgttttcttgccaaaaacttggtaaa
acaggaaagaagaaaaagagggaatag

DBGET integrated database retrieval system