KEGG   Felis catus (domestic cat): 101087107Help
Entry
101087107         CDS       T02385                                 

Gene name
TMX3
Definition
(RefSeq) thioredoxin related transmembrane protein 3
  KO
K09585  
thioredoxin domain-containing protein 10 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101087107 (TMX3)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101087107 (TMX3)
Membrane trafficking [BR:fca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101087107 (TMX3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
D3
AA seq 521 aa AA seqDB search
MRRGSAHAQRRRPARSWESRGGPPAPPPPCVQSFPSARPRPASLSGSSSLGRRCLFLLRG
LCSSPVASMAPRRRGAGLRLCATVFLLDMAFCKGFVEDLDESFKDNRKDDIWLVDFYAPW
CGHCKKLEPIWNEVGLEMKSIGSPVKVGKMDATSYSSIASEFGVRGYPTIKLLKGDLAYN
YRGPRTKDDIIEFAHRVSGALIRPLPSQQMFEHVQKRHRVFFVYIGGESPLKEKYIDAAS
ELIVYTYFFSASEDVVPEYVILKEMPAVLVFKDETYFVYDEYEDGDLSSWINRERFQNYL
TMDGFLLYELGDTGKLVAIAVIDEKNTSNEHTRLKSIIQEVARDYRDQFHRDFQFGHMDG
NDYINTLLMDELKVPTVVVLNTSNQQYFLLDRLIGSAEDMAHFIRDILDGTVPAQGGDSI
LQRLKRIIFDAKSTIVSIFKSSPLMGCFLFGLPLGVISIMCYGIYTADTDGGYIEERYEV
CRSEIESQEPVEDSKEQEPSGGATLGPTVQEPKDVLEKKKD
NT seq 1566 nt NT seq  +upstreamnt  +downstreamnt
atgcgccgcggttccgcgcatgctcagaggcggaggccggcgaggtcctgggagagtaga
ggaggcccgcctgccccgcccccgccctgcgtgcagagcttcccttccgcgcggccaagg
ccagcttccctttccgggagctcaagcctcggccgccggtgtctctttcttctccgcggc
ttgtgcagctctcccgtggcgagtatggcacctaggagacgcggggccggcctgcggctc
tgcgccactgtttttttacttgatatggctttctgtaaaggatttgtggaagatttagat
gaatcgtttaaagacaatcgaaaagatgacatctggcttgtagatttttatgcaccgtgg
tgtggccattgtaaaaaactggaaccgatttggaatgaagttggtcttgagatgaaaagc
attggttctccagttaaagttgggaagatggatgctacttcctattctagcattgcttca
gagtttggagttcgaggttatccaacaattaagctattaaaaggggacttggcatataat
tatagaggaccacgaactaaagatgatattattgagtttgctcacagagtatctggggct
ctaattcggccacttccaagtcagcagatgtttgaacatgtgcaaaagagacatcgtgtg
ttttttgtttatataggtggagagtcacctttgaaggagaaatacatagatgctgcttca
gaattaattgtatatacatacttcttttctgcctcagaagacgtggttcctgagtatgtg
atactgaaggagatgcctgctgtacttgttttcaaagatgaaacttactttgtttacgat
gagtacgaggatggtgatctgtcatcttggatcaacagggagaggtttcagaactatctt
accatggatggcttcctcttgtatgaacttggagacacaggaaagcttgtggcgattgca
gttattgatgagaaaaatacatcaaatgaacacaccagattaaagtcaattattcaggaa
gttgctagagattacagagaccagttccacagagattttcagtttggccatatggatgga
aatgactatataaatactttgctaatggatgaactgaaagtcccgactgtggttgtactg
aacacttcaaaccaacaatacttcttactggacagactgatcggcagtgccgaggacatg
gcacatttcattcgtgacatcttagatggcacagtcccggcccaaggaggtgatagcatt
ttgcagagattgaaaagaataatatttgatgccaaatcgactattgtgtctatattcaag
agctcgcccctcatgggctgctttctctttggccttccactgggtgtcatcagcatcatg
tgctacggcatctacacggcggacactgatggagggtacatagaagaacgatacgaggtg
tgcagaagtgaaatcgagagccaggaaccagtagaagacagcaaagaacaggagccaagc
ggtggagccaccctcgggcctacggtgcaagaacccaaagacgtattagagaagaagaaa
gattga

DBGET integrated database retrieval system