KEGG   Felis catus (domestic cat): 101087111Help
Entry
101087111         CDS       T02385                                 

Gene name
EHMT1
Definition
euchromatic histone-lysine N-methyltransferase 1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101087111 (EHMT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101087111 (EHMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 1277 aa AA seqDB search
MKTELLREEISMAADGGSSEKQGGEGPLASDGEANGSCGKSEASSHVTAAQHTQENTAVS
PQDGTNKLARIAENGVSDRDSETGKQNHVNTDDFTQTSVIGSNGYFLNKPPLQEQPMRIT
STLASSLPGHAAKTLPGGSGKGRTPSAFSQTPATAPAKLAEASKDTEDKKPSGPGADVKV
HRARKTMPKSILGLHATSKDPREVREARDHEEPKEEINKNLSDFGRQQLLPPFPPLHQSL
PQNQCYVATTKSQTACLPFVLAAAVSRKKKRRMGTYSLVPKKKTKVLKQRTVIEMFKSIT
HSTVGSKGDKDLGASTLHVNGESLELDSEEDESEELDEDEDQGAEQAAAFPTEDSRTSKG
VVPEADRTQKTDGESEEEQESAGTGEEDEDGDESDLSSESSIKKKFLKRKGKPDSPWIKP
ARKRRRRNKKKQSSILGSEAYTSSSGSTEQTAPGDSTGYMEVSLDSLDLRVKGTLPSHAE
GLANGPDLVETDGLQEVPLCSCRMETPKSREITTLANNQCMATESVDHELGRCTNSVVKH
ELMRPSSKAPLLVLCEDHRGRMVKHQCCPGCGYFCTAGNFMECQPESSISHRFHKDCASR
VNNASYCPHCGEEISKAKEVTIAKADTTSTVTLAPGQDKSSLAEGRADTTTGSTAGPSLL
EDGKPQSTAPQAAEGFDPTGPAGLVKPAPGLSQGPGKETLESALIALDSEKPKKLRFHPK
QLYFSARQGELQKVLLMLVDGIDPNFKMEHQNKRSPLHAAAEAGHVDICHMLIQAGANID
TCSEDQRTPLMEAAENNHLDAVKYLIKAGALVDPKDAEGSTCLHLAAKKGHYDVVQYLLS
NGQMDVNCQDDGGWTPMIWATEYKHVELVKLLLSKGSDINIRDNEENICLHWAAFSGCVD
IAEILLAARCDLHAVNVHGDSPLHIAAREDRYACVLLFLSRDSDVTLKNKEGETPLQCAS
LNSQVWDALQMSRALRDAAPDRPVPTEKTVSRDIARGYERIPIPCVNAVDNEPCPSNYKY
VSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNCMCGQLSMRCWYDKDGRLLPEFNMAEPP
LIFECNHACSCWRSCRNRVVQNGLRARLQLYRTQNMGWGVRSLQDIPLGTFVCEYVGELI
SDSEADVREEDSYLFDLDNKDGEVYCIDARFYGNVSRFINHHCEPNLVPVRVFMSHQDLR
FPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKLFSCRCGSPKCRHSSTAAAQRQASAAQD
GQENGLPDTSSSTADPL
NT seq 3834 nt NT seq  +upstreamnt  +downstreamnt
atgaaaacagagctgctgagggaagagatatctatggcagccgatggaggctcatcggag
aagcagggaggagagggccccctggcctcagacggcgaagctaatgggtcctgtggaaag
agcgaggctagcagccacgtgactgcagcccagcacactcaggagaacacagcggtcagc
ccacaggacggtaccaacaaactagctcgaatagctgaaaatggggtttcagacagagac
agtgaaacggggaagcaaaaccacgtcaacacagatgacttcacacagacttctgtcatc
gggagcaatgggtacttcttgaataaaccacccctgcaggaacagcccatgcggattacc
agcactttggcttcctcgcttcctggtcatgctgcaaaaacccttcccggaggttccggc
aaagggaggactcctagtgctttttctcagacgccagccacagcaccggccaagcttgcg
gaagcgagtaaagacacggaggacaagaagccctcgggccctggtgccgacgtcaaggtt
cacagggcacggaagaccatgccaaaatccatcctgggcctgcatgcaaccagtaaggat
cccagagaagttcgagaagctcgagatcatgaggagccaaaagaggagatcaacaaaaac
ctttctgattttggacgacagcagcttttaccccccttcccaccccttcatcaatcacta
cctcaaaatcagtgctacgtggccaccacaaagtcacagacagcttgcttgccttttgtt
ttagcagctgcagtatctcggaagaaaaaacgaagaatgggaacctatagcctggttcct
aagaaaaagaccaaagtattaaaacagaggacggtgattgagatgtttaagagtataact
cattccactgtgggctctaagggcgacaaggacctgggcgccagcaccctccacgtgaat
ggggagagcttggagctggactcggaggaggacgagtcggaggagctggatgaggacgag
gaccagggggctgagcaggccgccgcgttccccacggaggacagcaggacctctaagggg
gttgtgccagaggccgaccgcacccagaagacggacggcgagtctgaagaggagcaggaa
tcagccggcaccggggaggaggacgaggatggagacgagtccgatctgagttctgaatcc
agtatcaagaagaagtttctcaagaggaaagggaagcctgacagcccctggatcaagcct
gctaggaaacggaggcggagaaataaaaagaagcaaagcagtatcctgggttctgaagca
tatacgtcatcttcaggaagcacagagcagacggcaccaggagacagcacggggtacatg
gaagtttctctggactccctggatctccgtgtcaagggaacgctgccctcacacgcagaa
gggctggccaatggtcctgacttggtggagacggacggccttcaggaagtgcccctctgc
agctgccgaatggaaaccccgaaaagccgagagatcactactctggccaacaaccagtgt
atggctacggaaagcgtggaccacgaactgggcaggtgcaccaacagcgtggtcaagcac
gagctgatgcgcccatccagcaaagcgccgctcttggtgctgtgtgaagaccaccggggc
cggatggtgaagcaccagtgctgtcctggctgcggctacttctgcacagcgggtaatttt
atggaatgtcagcctgagagcagcatctctcaccgtttccacaaagactgtgcctctcga
gtcaataatgccagctattgtccccactgtggggaggagatctccaaggccaaagaggtg
accatcgcaaaagcggacacaacctctaccgtgacactggcccctgggcaggacaaaagc
tccctggcggagggcagggccgacaccaccacaggcagcactgctggaccatcgctcttg
gaggacggcaagccacagagcacggccccccaggcagccgagggcttcgaccccacaggg
cctgcggggctggtgaagccggcccccggcctttcccagggaccagggaaggagaccttg
gaaagtgctctgatcgctctagactcggaaaaacccaagaagcttcgcttccatccgaag
cagctatatttctccgccaggcaaggggagctgcagaaagtgctgctcatgctggtggat
ggaattgatcccaactttaagatggagcaccagaacaagcggtccccattgcacgctgcc
gccgaggccggccacgtggacatctgccacatgctgatccaggcgggcgcgaacattgac
acctgctcagaagaccagaggaccccattgatggaggcggcagaaaacaaccatttggat
gcagtgaagtacctcatcaaggccggcgccctcgtggacccgaaggatgcagagggctcc
acctgtttgcacctcgctgccaagaaaggccactatgatgtggttcagtatctgctttca
aatggacaaatggacgtcaactgtcaggatgatggcggctggacacccatgatttgggcc
actgagtataagcacgtggagctcgtgaagctgctgctgtccaaggggtctgacatcaac
atccgggacaacgaggagaacatctgtctacactgggctgcgttctctggctgcgtggac
atagctgagatcctgctggccgccaggtgtgacctgcatgccgtgaacgtgcacggagac
tcacccctgcacatcgccgccagggaggaccgctacgcctgcgtcctcctctttctttct
cgggattcagatgtcaccttgaaaaacaaagagggagagacgcccctgcagtgtgccagc
ctcaactcccaggtgtgggacgctctgcagatgagccgggcgttgcgggacgcagccccc
gacaggcctgtcccgacggagaagacggtgagcagagacattgctcgaggctatgagcga
atccccatcccgtgtgtcaacgctgtggacaatgagccgtgccccagcaactataaatac
gtttctcagaactgcgtgacgtcccccatgaacattgacagaaacatcacccatttgcag
tactgcgtgtgcattgacgactgctcttccagcaactgtatgtgtggccagctcagcatg
cgctgctggtacgacaaggacggccggctcctgccggagttcaacatggcggagccgccc
ttgatctttgagtgcaaccatgcctgttcctgctggaggagctgccggaaccgcgtcgtg
cagaacggtctcagggcgaggctgcagctctaccggacacagaacatgggctggggcgtg
cggtccctgcaggacatccccctgggcaccttcgtctgcgagtatgtgggagagctcatc
tctgactcggaagctgacgttcgggaagaagactcttacctctttgatcttgacaataag
gatggtgaggtgtactgcattgacgcgcggttctacgggaacgtcagccgcttcatcaac
catcactgcgagcccaacctggtgcccgtgcgcgtgtttatgtcacaccaggacctgcgc
tttcccaggattgccttcttcagcacccgcctgattgaggctggggagcagctggggttt
gactacggggagcgcttctgggacatcaaaggcaagctgttcagctgccgatgtggctcc
cccaagtgccggcactccagcacggccgcggcgcagcggcaggccagcgccgcccaggac
ggccaggagaacggcctgcccgacaccagctcctccaccgctgaccccctatga

DBGET integrated database retrieval system