KEGG   Felis catus (domestic cat): 101087111Help
Entry
101087111         CDS       T02385                                 

Gene name
EHMT1
Definition
euchromatic histone-lysine N-methyltransferase 1
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D4
AA seq 1304 aa AA seqDB search
MDSWRQRLLHLQGPHQECFAVPAKGETKQDCCMKTELLREEISMAADGGSSEKQGGEGPL
ASDGEANGSCGKSEASSHVTAAQHTQENTAVSPQDGTNKLARIAENGVSDRDSETGKQNH
VNTDDFTQTSVIGSNGYFLNKPPLQEQPMRITSTLASSLPGHAAKTLPGGSGKGRTPSAF
SQTPATAPAKLAEASKDTEDKKPSGPGADVKVHRARKTMPKSILGLHATSKDPREVREAR
DHEEPKEEINKNLSDFGRQQLLPPFPPLHQSLPQNQCYVATTKSQTAAAVSRKKKRRMGT
YSLVPKKKTKVLKQRTVIEMFKSITHSTVGSKGDKDLGASTLHVNGESLELDSEEDESEE
LDEDEDQGAEQAAAFPTEDSRTSKGVVPEADRTQKTDGESEEEQESAGTGEEDEDGDESD
LSSESSIKKKFLKRKGKPDSPWIKPARKRRRRNKKKQSSILGSEAYTSSSGSTEQTAPGD
STGYMEVSLDSLDLRVKGTLPSHAEGERLANGPDLVETDGLQEVPLCSCRMETPKSREIT
TLANNQCMATESVDHELGRCTNSVVKHELMRPSSKAPLLVLCEDHRGRMVKHQCCPGCGY
FCTAGNFMECQPESSISHRFHKDCASRVNNASYCPHCGEEISKAKEVTIAKADTTSTVTL
APGQDKSSLAEGRADTTTGSTAGPSLLEDGKPQSTAPQAAEGFDPTGPAGLVKPAPGLSQ
GPGKETLESALIALDSEKPKKLRFHPKQLYFSARQGELQKVLLMLVDGIDPNFKMEHQNK
RSPLHAAAEAGHVDICHMLIQAGANIDTCSEDQRTPLMEAAENNHLDAVKYLIKAGALVD
PKDAEGSTCLHLAAKKGHYDVVQYLLSNGQMDVNCQDDGGWTPMIWATEYKHVELVKLLL
SKGSDINIRDNEENICLHWAAFSGCVDIAEILLAARCDLHAVNVHGDSPLHIAAREDRYA
CVLLFLSRDSDVTLKNKEGETPLQCASLNSQVWDALQMSRALRDAAPDRPVPTEKTVSRD
IARGYERIPIPCVNAVDNEPCPSNYKYVSQNCVTSPMNIDRNITHLQYCVCIDDCSSSNC
MCGQLSMRCWYDKDGRLLPEFNMAEPPLIFECNHACSCWRSCRNRVVQNGLRARLQLYRT
QNMGWGVRSLQDIPLGTFVCEYVGELISDSEADVREEDSYLFDLDNKDGEVYCIDARFYG
NVSRFINHHCEPNLVPVRVFMSHQDLRFPRIAFFSTRLIEAGEQLGFDYGERFWDIKGKL
FSCRCGSPKCRHSSTAAAQRQASAAQDGQENGLPDTSSSTADPL
NT seq 3915 nt NT seq  +upstreamnt  +downstreamnt
atggactcgtggcggcagcggctgctgcacctgcagggaccccatcaggagtgttttgca
gttccggcgaagggggagacgaagcaggattgctgcatgaaaacagagctgctgagggaa
gagatatctatggcagccgatggaggctcatcggagaagcagggaggagagggccccctg
gcctcagacggcgaagctaatgggtcctgtggaaagagcgaggctagcagccacgtgact
gcagcccagcacactcaggagaacacagcggtcagcccacaggacggtaccaacaaacta
gctcgaatagctgaaaatggggtttcagacagagacagtgaaacggggaagcaaaaccac
gtcaacacagatgacttcacacagacttctgtcatcgggagcaatgggtacttcttgaat
aaaccacccctgcaggaacagcccatgcggattaccagcactttggcttcctcgcttcct
ggtcatgctgcaaaaacccttcccggaggttccggcaaagggaggactcctagtgctttt
tctcagacgccagccacagcaccggccaagcttgcggaagcgagtaaagacacggaggac
aagaagccctcgggccctggtgccgacgtcaaggttcacagggcacggaagaccatgcca
aaatccatcctgggcctgcatgcaaccagtaaggatcccagagaagttcgagaagctcga
gatcatgaggagccaaaagaggagatcaacaaaaacctttctgattttggacgacagcag
cttttaccccccttcccaccccttcatcaatcactacctcaaaatcagtgctacgtggcc
accacaaagtcacagacagcagctgcagtatctcggaagaaaaaacgaagaatgggaacc
tatagcctggttcctaagaaaaagaccaaagtattaaaacagaggacggtgattgagatg
tttaagagtataactcattccactgtgggctctaagggcgacaaggacctgggcgccagc
accctccacgtgaatggggagagcttggagctggactcggaggaggacgagtcggaggag
ctggatgaggacgaggaccagggggctgagcaggccgccgcgttccccacggaggacagc
aggacctctaagggggttgtgccagaggccgaccgcacccagaagacggacggcgagtct
gaagaggagcaggaatcagccggcaccggggaggaggacgaggatggagacgagtccgat
ctgagttctgaatccagtatcaagaagaagtttctcaagaggaaagggaagcctgacagc
ccctggatcaagcctgctaggaaacggaggcggagaaataaaaagaagcaaagcagtatc
ctgggttctgaagcatatacgtcatcttcaggaagcacagagcagacggcaccaggagac
agcacggggtacatggaagtttctctggactccctggatctccgtgtcaagggaacgctg
ccctcacacgcagaaggtgaacggctggccaatggtcctgacttggtggagacggacggc
cttcaggaagtgcccctctgcagctgccgaatggaaaccccgaaaagccgagagatcact
actctggccaacaaccagtgtatggctacggaaagcgtggaccacgaactgggcaggtgc
accaacagcgtggtcaagcacgagctgatgcgcccatccagcaaagcgccgctcttggtg
ctgtgtgaagaccaccggggccggatggtgaagcaccagtgctgtcctggctgcggctac
ttctgcacagcgggtaattttatggaatgtcagcctgagagcagcatctctcaccgtttc
cacaaagactgtgcctctcgagtcaataatgccagctattgtccccactgtggggaggag
atctccaaggccaaagaggtgaccatcgcaaaagcggacacaacctctaccgtgacactg
gcccctgggcaggacaaaagctccctggcggagggcagggccgacaccaccacaggcagc
actgctggaccatcgctcttggaggacggcaagccacagagcacggccccccaggcagcc
gagggcttcgaccccacagggcctgcggggctggtgaagccggcccccggcctttcccag
ggaccagggaaggagaccttggaaagtgctctgatcgctctagactcggaaaaacccaag
aagcttcgcttccatccgaagcagctatatttctccgccaggcaaggggagctgcagaaa
gtgctgctcatgctggtggatggaattgatcccaactttaagatggagcaccagaacaag
cggtccccattgcacgctgccgccgaggccggccacgtggacatctgccacatgctgatc
caggcgggcgcgaacattgacacctgctcagaagaccagaggaccccattgatggaggcg
gcagaaaacaaccatttggatgcagtgaagtacctcatcaaggccggcgccctcgtggac
ccgaaggatgcagagggctccacctgtttgcacctcgctgccaagaaaggccactatgat
gtggttcagtatctgctttcaaatggacaaatggacgtcaactgtcaggatgatggcggc
tggacacccatgatttgggccactgagtataagcacgtggagctcgtgaagctgctgctg
tccaaggggtctgacatcaacatccgggacaacgaggagaacatctgtctacactgggct
gcgttctctggctgcgtggacatagctgagatcctgctggccgccaggtgtgacctgcat
gccgtgaacgtgcacggagactcacccctgcacatcgccgccagggaggaccgctacgcc
tgcgtcctcctctttctttctcgggattcagatgtcaccttgaaaaacaaagagggagag
acgcccctgcagtgtgccagcctcaactcccaggtgtgggacgctctgcagatgagccgg
gcgttgcgggacgcagcccccgacaggcctgtcccgacggagaagacggtgagcagagac
attgctcgaggctatgagcgaatccccatcccgtgtgtcaacgctgtggacaatgagccg
tgccccagcaactataaatacgtttctcagaactgcgtgacgtcccccatgaacattgac
agaaacatcacccatttgcagtactgcgtgtgcattgacgactgctcttccagcaactgt
atgtgtggccagctcagcatgcgctgctggtacgacaaggacggccggctcctgccggag
ttcaacatggcggagccgcccttgatctttgagtgcaaccatgcctgttcctgctggagg
agctgccggaaccgcgtcgtgcagaacggtctcagggcgaggctgcagctctaccggaca
cagaacatgggctggggcgtgcggtccctgcaggacatccccctgggcaccttcgtctgc
gagtatgtgggagagctcatctctgactcggaagctgacgttcgggaagaagactcttac
ctctttgatcttgacaataaggatggtgaggtgtactgcattgacgcgcggttctacggg
aacgtcagccgcttcatcaaccatcactgcgagcccaacctggtgcccgtgcgcgtgttt
atgtcacaccaggacctgcgctttcccaggattgccttcttcagcacccgcctgattgag
gctggggagcagctggggtttgactacggggagcgcttctgggacatcaaaggcaagctg
ttcagctgccgatgtggctcccccaagtgccggcactccagcacggccgcggcgcagcgg
caggccagcgccgcccaggacggccaggagaacggcctgcccgacaccagctcctccacc
gctgaccccctatga

DBGET integrated database retrieval system