KEGG   Felis catus (domestic cat): 101087177Help
Entry
101087177         CDS       T02385                                 

Gene name
USP30
Definition
ubiquitin specific peptidase 30
Orthology
K11851  
ubiquitin carboxyl-terminal hydrolase 30 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101087177 (USP30)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101087177 (USP30)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D3
AA seq 517 aa AA seqDB search
MLSSRAQAAMTAADRAIQRFLRTGAAVRYKVMKNWGVIGGLAAALAAGIYVIWGPITERK
KRRKGLVPGLVNLGNTCFMNSLLQGLSACPAFIKWLEEFTTQYTRDQKEPPPHQYLSLTL
LHLLKALSCQEVTDDEVLDASCLLDVLRMYRWQISSFEEQDAHELFHVITSSLEDERDRQ
PRVTHLFDVHSLEQQPEITPKQITCRTRGSPHPTSNHWKSQHPFHGRLTSNMICKHCEHQ
SPVRFDTFDSLSLSIPAATWGHPLTLDHCLHHFISSESVRDVVCDNCTQIEAKGTLDGEK
VEHQRTTFVKQLKLGKLPQCLCIHLQRLSWSSHGTPLKRHEHVQFNEFLMMDIYKYHLLG
HRPGQHSPKPGESAGPSLDLQDGPAAPRSVLNQPGGPKTQIFMNGACSPSLLPTLPAPMP
FPLPVVPDYSSSTYLFRLMAVVVHHGDMHSGHFVTYRRSPPSAKNPLSTSNQWLWISDDT
VRKASLQEVLSSSAYLLFYERVLSKMQHQGREYRSEE
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
atgctgagctcccgggcccaggcggcgatgaccgcggccgacagggccatccagcgcttc
ctgcggaccggggcggccgtcagatataaagtcatgaagaactggggtgttataggggga
cttgctgctgcccttgccgcagggatctatgtgatttggggtcccattacagaaagaaag
aagcgtagaaaagggctggtgcccgggctggtcaacttagggaacacctgcttcatgaac
tccctgctgcaaggcttgtctgcctgccccgctttcatcaagtggctggaagagtttacc
acccagtacaccagggatcagaaggagccccccccacaccagtatttatccttaaccttg
ttgcacctcctcaaagctttgtcctgccaagaagttactgacgatgaggtcttagatgcg
agctgcttgttggatgtcttaagaatgtacagatggcagatctcttcatttgaagaacag
gatgcccacgagttattccacgtcattacctcgtccttggaagatgagcgggaccggcag
ccccgggtcacacatttgtttgatgtgcactccctggagcagcagccagagataactcct
aaacaaataacctgccgtacgagagggtcacctcaccccacgtccaatcactggaaatcc
cagcatcccttccatgggagacttacgagcaacatgatctgcaaacactgtgagcaccag
agtcccgttcgattcgataccttcgatagcctttcactgagtattccagctgccacatgg
gggcatccactgaccctggaccactgccttcaccactttatctcatcagaatcagtgcgg
gacgtcgtatgtgacaactgtacgcagatcgaagccaaagggacgttggatggggagaag
gtggaacaccagaggaccacctttgtcaagcagctgaaactagggaagctccctcagtgt
ctgtgcatccacctgcagcggctgagctggtccagccacggcacgcccctgaagcgccat
gagcacgtgcagttcaatgagttcctgatgatggacatctacaagtaccacctcctgggg
cacagacccgggcagcacagccctaaacccggcgagagcgcggggccctcgctcgacctg
caggacgggccggccgcccccagatcagttttgaatcagccagggggtccgaaaacacaa
atttttatgaatggcgcctgctccccatctttattgcctaccctgccagccccaatgccc
ttccccctcccagttgttcctgactacagttcctccacgtacctcttccggctgatggcg
gttgtcgtccaccatggagacatgcactcaggacacttcgtgacttaccgacggtcccca
ccttcggccaagaaccctctctccaccagcaaccagtggctgtggatctccgatgacacc
gtccgcaaggcgagcctgcaggaggtgctgtcctccagcgcttacctgctgttttacgag
cgcgtcctttccaagatgcagcaccagggccgggagtacaggtcggaggaatga

DBGET integrated database retrieval system