KEGG   Felis catus (domestic cat): 101087199Help
Entry
101087199         CDS       T02385                                 

Gene name
THBS4
Definition
thrombospondin 4
Orthology
K04659  
thrombospondin 2/3/4/5
Organism
fca  Felis catus (domestic cat)
Pathway
Phagosome
PI3K-Akt signaling pathway
Focal adhesion
ECM-receptor interaction
Malaria
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04151 PI3K-Akt signaling pathway
    101087199 (THBS4)
  Signaling molecules and interaction
   04512 ECM-receptor interaction
    101087199 (THBS4)
 Cellular Processes
  Transport and catabolism
   04145 Phagosome
    101087199 (THBS4)
  Cellular commiunity
   04510 Focal adhesion
    101087199 (THBS4)
 Human Diseases
  Infectious diseases
   05144 Malaria
    101087199 (THBS4)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   101087199 (THBS4)
  Exosomal proteins of colorectal cancer cells
   101087199 (THBS4)
  Exosomal proteins of bladder cancer cells
   101087199 (THBS4)
Heparan sulfate/heparin binding proteins [BR:fca00536]
 Extracellular matrix molecules (General comment) Storage depot, cell adhesion and motility, ECM/barrier formation
  101087199 (THBS4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A1
AA seq 964 aa AA seqDB search
MLAPRGAAFLLLHLALQPWLGAGAQATPQVFDLLPSSSQRLNPAVLQPILTDPTLNEVYV
ISTFKLHSKSSSTILGLYSSVDGSKYFEFTVMGRLNKAVLRYLKNDGRIHLVVFNNLHLA
DGRRHRVLLRLTNLRRGTGSVELYMDCTQVDSVHNLPRAFSGSSQSPESIELRTFQRKAQ
DSLEELKLVVRGSLFQVASLQDCFLQQSEPLATTSTGDFNRQFLGQMTQLNQLLGEVKDL
LRQQVKETSFLRNTIAECQACGPLSFQSPTPNTLVPPASPAPTTSSTPPVRRCDSNSCFR
GVRCTDTRDGFQCGPCPEGYTGNGITCSDIDECKYHPCYPGVRCVNLAPGFRCDACPMGF
TGPMVQGVGISFAKSNKQVCTDIDECQNGACVLNSICINTLGSYRCGPCKPGYTGDQTTG
CKTERSCRNPELNPCSVNAQCIEERQGDVTCVCGIGWAGDGYICGKDVDIDSYPDEELPC
SARNCKKDNCKYVPNSGQEDADRDGIGDACDDDADGDGILNEQDNCVLTHNVDQRNSDKD
IFGDACDNCRNVLNNDQKDTDGDGKGDACDDDMDGDGIKNILDNCPKVPNRDQRDRDGDG
VGDACDSCPDVSNPNQSDVDNDLVGDSCDTNQDSDGDGHQDSTDNCPTVINSAQLDTDKD
GIGDECDDDDDNDGIPDVVPPGPDNCRLVPNPAQEDSNSDGVGDICETDFDQDQVIDRID
VCPENAEVTLTDFRAYQTVVLDPEGDAQIDPNWVVLNQGMEIVQTMNSDPGLAVGYTAFN
GVDFEGTFHVNTQTDDDYAGFIFGYQDSSSFYVVMWKQTEQTYWQATPFRAVAEPGIQLK
AVKSKTGPGEHLRNSLWHTGDTSDQVRLLWKDSRNVGWKDKVSYRWFLQHRPQVGYIRVR
FYEGSELVADSGVTIDTTMRGGRLGVFCFSQENIIWSNLKYRCNDTIPEDFQEFQTQNFD
RLDN
NT seq 2895 nt NT seq  +upstreamnt  +downstreamnt
atgctggccccgcgcggagccgccttcctcctgctgcacctggccctgcagccgtggcta
ggggccggcgcccaggccaccccccaggtctttgaccttctcccatcttccagccagagg
ctgaacccagctgttctgcagccaatcctgacagatcccaccttgaatgaggtctatgtg
atctccaccttcaagctgcattctaaaagttcatccaccatcttgggcctttactcttca
gttgatggcagcaaatattttgaattcactgtgatgggacgcttaaacaaagctgtactc
cgttacctgaagaacgatgggaggattcatttggtggttttcaacaacctgcatctggct
gatggcaggcggcacagggtcctcctgagactcaccaacttgcggcgagggactggctct
gtagagctctacatggactgcacccaagtggattctgttcacaatctccccagagccttt
tccggctcttcccagagtcctgagtccattgaattaaggaccttccagaggaaggcacag
gattccttggaagagctgaagctggtggtgaggggctcactgttccaggtggccagcctg
caagactgcttcctacagcagagcgagccactggccaccacaagcacaggagactttaat
cggcagttcttggggcaaatgacccaactcaaccagctcctgggagaggtgaaggatctt
ctgagacagcaggtcaaggaaacatcatttttgcgaaataccatagctgagtgccaggct
tgcggtccactgagctttcagtctccaaccccaaacacgctggtgccccctgcatcccca
gcgcccacgacatcctcgacacccccagtgcgccgctgtgattctaactcctgtttccgc
ggcgtccgatgtactgacaccagagatggctttcaatgtgggccctgccctgagggctac
acaggaaatgggatcacctgttctgatattgatgagtgcaaataccatccctgctaccca
ggtgtgcgctgtgtgaacttggctcccggcttcagatgtgatgcgtgccccatgggcttc
acagggcccatggtacagggtgttgggatcagttttgccaagtcaaacaagcaggtctgc
actgacattgatgagtgtcaaaacggagcgtgtgttctcaactctatctgtattaacact
ctgggatcttaccgctgcgggccttgcaaaccggggtacactggtgatcagacaacggga
tgcaaaaccgaaaggagctgcagaaatcctgagctgaatccttgcagtgtgaatgcacag
tgcattgaagagaggcaaggggatgtgacatgtgtgtgtggcattggttgggctggcgat
ggctatatctgcggaaaggatgtggacattgacagttaccccgacgaagaactgccgtgc
tctgccaggaactgcaagaaggataattgcaagtatgtgccaaattctggccaagaagat
gcagacagagatggcataggagatgcttgtgacgacgacgctgacggagacgggatcttg
aatgagcaggataactgtgtcctgactcacaatgtggaccaaaggaacagtgacaaagat
atctttggggacgcctgtgacaactgccggaatgtcctgaataatgaccagaaagacact
gatggagatggaaaaggagacgcctgtgatgatgacatggatggagatggaataaaaaac
attctggacaactgcccaaaagttcccaatcgtgaccaacgggacagggatggtgatggc
gtgggggatgcctgtgacagttgtcctgatgtcagtaaccctaaccagtctgatgtggat
aacgacctggttggggactcctgtgacaccaatcaggacagtgatggagatggacaccag
gacagcacagacaactgccccaccgtcattaacagcgcccagctggacactgataaggat
ggcatcggtgacgagtgtgatgacgatgatgacaacgatggcatcccagacgtggtgccc
ccgggaccagacaactgcaggctggtccccaacccagcccaggaggatagcaacagcgat
ggcgtgggagacatctgtgagactgactttgaccaggaccaggtcatcgatcggatcgat
gtctgcccagagaatgcggaggtcacactgactgacttcagggcctaccagacagtagtc
ctggaccctgaaggggatgcccagatcgatcccaattgggtggtcctgaaccagggcatg
gagattgtgcagactatgaacagcgatcctggcctggcagtggggtacacggcatttaac
ggagttgactttgaagggaccttccacgtaaacacccagacagatgacgactacgctggc
ttcatctttggttaccaagacagctccagcttctacgtagtcatgtggaagcagacagag
cagacatattggcaagccacgccattccgcgctgtggcggaacctggcatccagcttaag
gctgttaagtctaagacaggcccgggggagcatctccgcaactccctgtggcacaccggg
gacacgagtgaccaggtccggctgctgtggaaggactcgaggaacgttggctggaaggac
aaggtgtcctaccgctggttcctgcagcacaggccccaggtgggctacataagagtgcgc
ttttatgaaggctctgagttggtagctgactccggggtcaccatagacaccaccatgcgt
ggaggccggctcggcgtgttctgcttctcccaagaaaacatcatttggtccaacctcaaa
tatcgctgcaatgacaccatcccagaggacttccaagagtttcaaacccagaatttcgat
cgcctggataattaa

DBGET integrated database retrieval system