KEGG   Felis catus (domestic cat): 101087295Help
Entry
101087295         CDS       T02385                                 

Definition
uncharacterized LOC101087295
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101087295
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   101087295
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
F1
AA seq 463 aa AA seqDB search
MTACHPEGVHLQPSGRHVASHPLTLVYRPHGLQNRSHSSRHSIEDKFAFCLCTKIPLPNP
RAGATPPGAEAAGGGGGRGGVKRALRTLACGKLWKHKPERSGIREGPTLGSVSAWPSEVV
PTAMLGCGMRDMEDELNLGRPRGRSDRTKGPSRPPAVFSPVLAGRPSEPAAPLGEALRGA
GKRLEAAAALRAVTAPTPPTPGPAGSAPGNEPRPSTFAPPSLQTGEDPGCYLLRRTESPP
FLLRPRPLPNPLRVLHGLGRVSLSLGWLERPPALSRAAGCRGAQVEEIWSLEPENFEKLK
PVHGLIFLFKWQPGEEPAGSVVQDSRLDTIFFAKQVINNACATQAIVSVLLNCTHQDVHL
GETLSEFKEFSQSFDAAMKGLALSNSDVIRQVHNSFARQQMFEFDAKTSAKEEDAFHFVS
YVPVNGRLYELDGLREGPIDLGACNQDDWISAVRPVIEKRIQK
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgacagcatgccatcccgaaggcgtgcatcttcagccaagtggtcgccatgtagcatcg
catccccttacacttgtctatcgtccccacggattacagaacagatctcactcttctcgt
cattccatcgaggataaattcgccttctgtctttgcaccaaaatccctcttccaaacccc
agagccggggcaacgcctcccggcgcagaagccgcgggaggagggggaggaagaggagga
gtaaagcgggccctccggacgctggcctgtgggaagctatggaagcacaagccggagcgg
tccgggattcgggaagggcccaccctcgggagcgtctcagcctggccaagcgaggttgtg
cccacagcgatgctgggatgcgggatgagggacatggaggatgagctaaaccttgggcgt
ccccggggccgctcagaccgcacaaagggccccagtcggcctcccgcagttttctcacct
gtgcttgccggccgaccctccgaacccgcagcgccactgggagaagccctgcgaggcgcg
ggaaaacgactagaagctgctgcagcccttagggcggtaactgctccaactccaccaacg
ccggggcctgcaggttcggctcccgggaacgagccccgcccctctacttttgccccgccc
tcgctccagactggcgaggatcccggatgttacctcctccggcgtactgagtccccgccc
tttcttcttaggccccggccccttccgaatccgctacgggtcctgcacggcctaggaaga
gtttcactgtctcttgggtggctagagcgtcctcccgcgcttagtcgcgctgcaggttgc
cgaggagcccaagtagaagaaatatggagtttagagcctgagaattttgaaaaattaaag
ccagttcatgggttaatttttcttttcaagtggcagccaggagaagaaccagcaggctct
gtagttcaggactccagacttgacacaatattttttgccaagcaggttattaacaatgct
tgtgctacccaagctatagtcagtgtgttactgaactgtacccatcaagatgtccattta
ggagagacattgtcagaatttaaagaattttcacaaagttttgatgcagctatgaaaggt
ttggcactgagcaattcagatgtgattcgacaagtacacaacagttttgccagacagcaa
atgtttgaatttgatgcaaagacgtccgcaaaagaagaagatgcttttcattttgtcagt
tatgttcctgtaaacggaagattgtatgaattagatggattaagagaaggaccgattgat
ttaggtgcatgcaatcaagatgactggatcagcgcagtgaggccggtcatagaaaaaagg
atacaaaagtaa

DBGET integrated database retrieval system