KEGG   Felis catus (domestic cat): 101087309Help
Entry
101087309         CDS       T02385                                 

Gene name
EZH2
Definition
enhancer of zeste homolog 2 (Drosophila)
Orthology
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101087309 (EZH2)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101087309 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 746 aa AA seqDB search
METAKDTACPHPDFCELIARDQGGHSPALPSTIFHNTVFTWNQPSAKSLSLVVSSYNYYF
WLDFPLQLPVVQPHSRLLYQLVDCSVTSDLDFPTQIIPLKTLNAVASVPIMYSWSPLQQN
FMVEDETVLHNIPYMGDEVLDQDGTFIEELXKNYDGKVHGDRECGFINDEIFVELVNALG
QYNDDDDDDDGDDPDEREEKQKDLEENRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEE
LKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPF
HATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLP
NNSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPV
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNDFVVDATRKGNKIRFANHSVNPNCYAKVMMVNGDHRIGIFAKRAIQTGE
ELFFDYRYSQADALKYVGIEREMEIP
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaaggatacagcctgtccacatcctgacttctgtgagctcattgcgcgg
gaccagggaggccattcacctgctcttccctctacgattttccataacacagtttttact
tggaaccagccttctgccaagagtctcagtttggttgtgtcctcctacaactactatttt
tggcttgacttccctctccagctcccagtggtccagccacacagtcgcctattgtaccag
ctggttgattgttcagtgaccagtgacttggattttccaacgcaaatcatcccattaaag
actctgaatgcagtcgcttcagtacccataatgtattcttggtctcccctacagcagaat
tttatggtggaagatgaaacagttttacataacattccttatatgggggatgaagtttta
gaccaggatgggactttcattgaagagctanataaaaactatgatggaaaagtacacggg
gatagagaatgcgggtttataaatgatgaaatttttgtggagttggtgaatgctcttggt
cagtacaatgatgatgatgatgatgatgatggcgatgaccctgatgaaagagaagaaaaa
cagaaagatctggaggagaacagagatgacaaagaaagccgcccgcctcggaaatttcct
tccgataaaatttttgaagccatttcttcaatgtttccagataagggcacagcagaagaa
ctaaaggaaaagtataaagaactgaccgagcagcagctcccgggcgcacttcctcctgag
tgcaccccgaacatcgacgggccgaacgccaagtccgtgcagagggagcagagcctgcac
tctttccacacgctcttctgcaggcggtgcttcaagtacgactgcttcctgcaccctttt
cacgcaacacccaacacttataagcggaagaacacagaaacggctctagacaacaagccg
tgtggaccacagtgttaccagcacttggagggagcaaaggagtttgccgctgccctcacc
gccgagcggataaagacgccgccgaagcggcccggaggccgcaggagaggacggctcccc
aacaacagcaggcccagcacccccaccattaacgtgctggaatcgaaagacacagacagc
gaccgggaagcggggacggagacgggcggggagaacaacgataaagaggaggaggagaaa
aaagacgagacttccagttcctcggaagcgaattctcgatgtcaaacgccaataaagatg
aagccaaatatcgagcctcccgaaaacgtggagtggagtggtgccgaggcctcgatgttc
agggtcctcattggcacgtattatgacaatttctgtgccattgccaggctcatcgggacc
aagacttgtaggcaggtgtatgagttccgtgtcaaagaatccagcatcatagctccggtg
ccggccgaggatgtggacacccctccaaggaagaagaagaggaaacaccggttgtgggct
gcacactgcagaaagatacagctgaaaaaggatggctcctctaaccacgtttacaactac
cagccctgtgaccatccgcgtcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcagtgtagttcagagtgtcagaaccgctttcccggctgc
cgctgcaaagcccagtgcaacaccaagcagtgcccgtgctacctggccgtgcgcgagtgc
gaccccgacctctgcctcacctgtggtgcggccgaccactgggacagcaaaaatgtgtcc
tgcaagaactgtagcatccagcggggctccaagaagcacctgctgctggcgccgtccgac
gtggcgggctgggggattttcatcaaagatcccgtacagaaaaatgaattcatctcggag
tactgtggagagattatttctcaagatgaagcagacagaagagggaaagtctacgacaaa
tacatgtgcagctttctgttcaacttgaacaatgattttgtggtggatgcaacccgcaag
ggtaacaagattcgttttgcaaatcattcagtaaatccaaactgctatgcaaaagttatg
atggttaacggcgatcacaggatagggatttttgctaagagagccatccagactggtgaa
gagctgttttttgattacagatacagccaggccgacgccctcaagtacgtgggcatcgag
agagaaatggaaatcccttga

DBGET integrated database retrieval system