KEGG   Felis catus (domestic cat): 101087309Help
Entry
101087309         CDS       T02385                                 

Gene name
EZH2
Definition
(RefSeq) enhancer of zeste 2 polycomb repressive complex 2 subunit
  KO
K11430  
histone-lysine N-methyltransferase EZH2 [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
MicroRNAs in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    101087309 (EZH2)
 Human Diseases
  Cancers
   05206 MicroRNAs in cancer
    101087309 (EZH2)
Enzymes [BR:fca01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     101087309 (EZH2)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     101087309 (EZH2)
   Polycomb group proteins
    PRC2-EZH2 complex
     101087309 (EZH2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 757 aa AA seqDB search
METAKDTACPHPDFCELIARDQGGHSPALPSTIFHNTVFTWNQPSAKSLSLVVSSYNYYF
WLDFPLQLPVVQPHSRLLYQLVDCSVTSDLDFPTQIIPLKTLNAVASVPIMYSWSPLQQN
FMVEDETVLHNIPYMGDEVLDQDGTFIEELIKNYDGKVHGDRECGFINDEIFVELVNALG
QYNDDDDDDDGDDPDEREEKQKDLEENRDDKESRPPRKFPSDKIFEAISSMFPDKGTAEE
LKEKYKELTEQQLPGALPPECTPNIDGPNAKSVQREQSLHSFHTLFCRRCFKYDCFLHPF
HATPNTYKRKNTETALDNKPCGPQCYQHLEGAKEFAAALTAERIKTPPKRPGGRRRGRLP
NNSRPSTPTINVLESKDTDSDREAGTETGGENNDKEEEEKKDETSSSSEANSRCQTPIKM
KPNIEPPENVEWSGAEASMFRVLIGTYYDNFCAIARLIGTKTCRQVYEFRVKESSIIAPV
PAEDVDTPPRKKKRKHRLWAAHCRKIQLKKDGSSNHVYNYQPCDHPRQPCDSSCPCVIAQ
NFCEKFCQCSSECQNRFPGCRCKAQCNTKQCPCYLAVRECDPDLCLTCGAADHWDSKNVS
CKNCSIQRGSKKHLLLAPSDVAGWGIFIKDPVQKNEFISEYCGEIISQDEADRRGKVYDK
YMCSFLFNLNNGRSEGVASASQGSFWGCRERLCLTSKRRALLPARKQAVGEATRLNRMVQ
SRWPLVLRLLQLGDVLRVCPGAWAAGWGESAGSRRGL
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagcgaaggatacagcctgtccacatcctgacttctgtgagctcattgcgcgg
gaccagggaggccattcacctgctcttccctctacgattttccataacacagtttttact
tggaaccagccttctgccaagagtctcagtttggttgtgtcctcctacaactactatttt
tggcttgacttccctctccagctcccagtggtccagccacacagtcgcctattgtaccag
ctggttgattgttcagtgaccagtgacttggattttccaacgcaaatcatcccattaaag
actctgaatgcagtcgcttcagtacccataatgtattcttggtctcccctacagcagaat
tttatggtggaagatgaaacagttttacataacattccttatatgggggatgaagtttta
gaccaggatgggactttcattgaagagctaataaaaaactatgatggaaaagtacacggg
gatagagaatgcgggtttataaatgatgaaatttttgtggagttggtgaatgctcttggt
cagtacaatgatgatgatgatgatgatgatggcgatgaccctgatgaaagagaagaaaaa
cagaaagatctggaggagaacagagatgacaaagaaagccgcccgcctcggaaatttcct
tccgataaaatttttgaagccatttcttcaatgtttccagataagggcacagcagaagaa
ctaaaggaaaagtataaagaactgaccgagcagcagctcccgggcgcacttcctcctgag
tgcaccccgaacatcgacgggccgaacgccaagtccgtgcagagggagcagagcctgcac
tctttccacacgctcttctgcaggcggtgcttcaagtacgactgcttcctgcaccctttt
cacgcaacacccaacacttataagcggaagaacacagaaacggctctagacaacaagccg
tgtggaccacagtgttaccagcacttggagggagcaaaggagtttgccgctgccctcacc
gccgagcggataaagacgccgccgaagcggcccggaggccgcaggagaggacggctcccc
aacaacagcaggcccagcacccccaccattaacgtgctggaatcgaaagacacagacagc
gaccgggaagcggggacggagacgggcggggagaacaacgataaagaggaggaggagaaa
aaagacgagacttccagttcctcggaagcgaattctcgatgtcaaacgccaataaagatg
aagccaaatatcgagcctcccgaaaacgtggagtggagtggtgccgaggcctcgatgttc
agggtcctcattggcacgtattatgacaatttctgtgccattgccaggctcatcgggacc
aagacttgtaggcaggtgtatgagttccgtgtcaaagaatccagcatcatagctccggtg
ccggccgaggatgtggacacccctccaaggaagaagaagaggaaacaccggttgtgggct
gcacactgcagaaagatacagctgaaaaaggatggctcctctaaccacgtttacaactac
cagccctgtgaccatccgcgtcagccttgtgacagttcgtgcccttgtgtgatagcacaa
aatttttgtgaaaagttttgtcagtgtagttcagagtgtcagaaccgctttcccggctgc
cgctgcaaagcccagtgcaacaccaagcagtgcccgtgctacctggccgtgcgcgagtgc
gaccccgacctctgcctcacctgtggtgcggccgaccactgggacagcaaaaatgtgtcc
tgcaagaactgtagcatccagcggggctccaagaagcacctgctgctggcgccgtccgac
gtggcgggctgggggattttcatcaaagatcccgtacagaaaaatgaattcatctcggag
tactgtggagagattatttctcaagatgaagcagacagaagagggaaagtctacgacaaa
tacatgtgcagctttctgttcaacttgaacaatggtaggtctgagggggtggcatctgcg
agccaggggtccttttggggctgcagggagcgtctctgcctcacttccaagcgtcgggcg
cttctccccgcccggaaacaggctgttggcgaggccaccaggctgaaccggatggttcag
agccgctggccgctagtgctgcgcctgctccagctgggagacgtgctgcgggtttgcccc
ggggcctgggcggcggggtggggggagtctgccgggtctcgtcggggcctctga

DBGET integrated database retrieval system