KEGG   Felis catus (domestic cat): 101087429Help
Entry
101087429         CDS       T02385                                 

Gene name
DAO
Definition
(RefSeq) D-amino-acid oxidase isoform X3
  KO
K00273  D-amino-acid oxidase [EC:1.4.3.3]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00260  Glycine, serine and threonine metabolism
fca00330  Arginine and proline metabolism
fca00472  D-Arginine and D-ornithine metabolism
fca01100  Metabolic pathways
fca04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    101087429 (DAO)
   00330 Arginine and proline metabolism
    101087429 (DAO)
  Metabolism of other amino acids
   00472 D-Arginine and D-ornithine metabolism
    101087429 (DAO)
  Biosynthesis of other secondary metabolites
   00311 Penicillin and cephalosporin biosynthesis
    101087429 (DAO)
 Cellular Processes
  Transport and catabolism
   04146 Peroxisome
    101087429 (DAO)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.3  D-amino-acid oxidase
     101087429 (DAO)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAO Pyr_redox UDPG_MGDP_dh_N FAD_binding_2
Motif
Other DBs
NCBI-GeneID: 101087429
NCBI-ProteinID: XP_003994910
Ensembl: ENSFCAG00000011289
UniProt: M3WEU2
Position
D3
AA seq 347 aa AA seqDB search
MRVVVIGAGVIGLSTALCIHERYRSVLPSLDMRVYADRFTPLTNTDVAAGLCQPYLSDPR
NPQEADWNQQTFDYLLSRVHSPNAANVGLALVSGYNLFHEAIPDPSWKNTVLGFRTLTPR
DLDMFPDYSYGWFNTSLIVEGRRYLQWLTERLTERGVKFFQKKVESFEEVARGGADVIIN
CTGVWAGSLQPDPLLQPGRGQIIKVDAPWMKHFIITHDPEKGIYKSPYIIPGIQAVTLGG
IFQLGNWSEVNNIQDHNTIWEGCCRLEPTLQDAKIVAELTGLRPVRPQIRLERERLRFAS
SNTEVIHNYGHGGYGLTIHWGCALEAAKLFGKILEERKLLKMPPPHL
NT seq 1044 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgtggtagtgatcggagcgggtgtcatcgggctgtccaccgccctctgcatccac
gagcggtaccgatcagtcctgccatccctggacatgagggtctacgccgatcgcttcacc
ccgctcaccaacaccgacgtggcggccggcctctgtcagccctacctctcggaccccaga
aacccacaggaggcggattggaaccagcagaccttcgactatctcctgagccgcgtccat
tctcccaacgccgcaaacgtgggcctggctctagtctcaggctacaacctcttccatgaa
gctattccggatccctcgtggaagaacacagttctgggatttcggacgctgactcccagg
gacctggacatgttccctgattacagctacggctggttcaacacaagcctgattgtggaa
gggaggaggtatctacagtggctgactgaaaggttaactgagaggggagtgaaattcttc
cagaagaaggtggagtcttttgaggaggtagcaagaggaggtgccgatgtaattatcaac
tgcaccggggtgtgggctgggtcattgcaaccggaccccctgctgcagccaggccgggga
cagatcattaaggtggatgccccttggatgaagcacttcattatcacccatgacccagag
aaaggcatctacaagtccccgtacatcatcccagggatccaggcagtgactcttggaggc
atctttcagctggggaactggagcgaggtaaacaacatccaggaccacaacaccatctgg
gaaggctgctgcagactggagcccacactgcaggatgcaaaaattgttgctgagttgact
ggcctccggccagtgcgcccccagattcggctagaaagagaacggcttcgttttgcatct
tcaaacacagaggtcatccacaactatggccatggaggctacgggctcactatccactgg
ggctgtgccctggaggcagccaagctctttgggaaaattctggaagaaaggaagttgctc
aagatgccgccacctcacctctga

DBGET integrated database retrieval system