KEGG   Felis catus (domestic cat): 101087486Help
Entry
101087486         CDS       T02385                                 

Gene name
UNC13C, munc-13
Definition
unc-13 homolog C (C. elegans)
Orthology
K15293  
protein unc-13
Organism
fca  Felis catus (domestic cat)
Pathway
Synaptic vesicle cycle
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Nervous system
   04721 Synaptic vesicle cycle
    101087486 (UNC13C)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B3
AA seq 2217 aa AA seqDB search
MVANLFKSLILPYIHKLCKGMFTKKLGNTTKXKENRQHKKDQDFPTAGQTKTPKFSNTLK
STVKKIAKCSSTRNLSTEEDETNKEFSLSPTFSYRVAIANGLQKNINVTNSDNEDLLQEL
SSIESSYSESLNELRSSTENQAQSTHTMPVRRNRKSSSSLAPSEGSSDGERTLHSLKLGA
LRKLRKWKKSQECVSSDSELSTMKKTWGIRSKSLDRTARNPKTNALEPGFSSSGCISQTH
DVMEMIFKELQGISQIETELSELRGHVNALKHSIDEISSSVEVVQSEIEQLRTGFVQSRR
ETRDIHDYIKHLGHMGSKASLRFLNVPEERFEYIESVVYQILVDKMGFSDVPNAIKIEFA
QRIGHQRDCPNAKPRPILVYFETPQQRDSVLKKSYKLKGTGIGISTDILTHDIRERKERG
IPSSQTYESMDIKLSTPEPKSKKNNWQSPDDSDGELESDLNRNSYAVLSKSEFPTKGSTS
KSSSKSHNSRAKNKTASGSRISSKSDYDKISSQLPESDNLEKQTTTHYADATPLWHSQSD
FFTAKLSRSESDFSKLCQSYSEDFSENQFFTRTNGSSLLSSSDRELWQRKQEGTATLYDS
PQNQHLKGALQGAQGQSEIENTETVDSGMSNGMVCASGDRSHYSDSQLSLHEDLSPWKEW
NQVEQGTDLGLDSSTQEAFDYDTNSLSDQQLDVYNKDLEDLGKGHSDFQDDSESYDLTQD
DNSSPCPGLDNEPQGQWVGQYDSYQEANSNDLYQNQNQLSMMYRSQSELQSDDSEDAPPK
SWHSRLSIDLSDKSFSFPKFGSTLQRAKSALEVVWNKSTQSLSGYEDSGSSLMGRFRTLS
QSTANESSTTLDSDVYTEPFYYKAEDEEDYSEPVADNETDYVEVMEQVLAKLENRTSMTE
TDEQMQVYDHPSYETPYETPQDEGYDVQADDMVSEGGLEPLNETSAEMEIKEDENQNIPE
QPMEIIKPKRIRPSFKEAALKAYKKQMAELEEKILAGDSSSVDEKARIVSGNDLEAAKFS
GLQAIGGAGRGLYGIDSMPDLRRKKTLPIVRDVAMTLAARKSGLSLAMVIRTSLNNEELK
IHVFKKTLQALIYPMSSTTPHNFEVWTATTPTYCYECEGLLWGIARQGMKCLECGVKCHE
KCQDLLNADCLQRAAEKSSKHGAEDKTQTIITAMKERMKIREKNRPEVFEVIQEMFQISK
EDFVQYTKAAKQSVLDGTSKWSAKITITVVSAQGLQAKDKTGSSDPYVTVQVGKNKRRTK
TIFGNLNPVWDEKFYFECHNSTDRIKVRVWDEDDDIKSRVKQHFKKESDDFLGQTIVEVR
TLSGEMDVWYNLEKRTDKSAVSGAIRLKINVEIKGEEKVAPYHIQYTCLHENLFHYLTEV
KSNGGVKIPEVKGEEAWKVFFDDASQEIVDEFAMRYGIESIYQAMTHFSCLSSKYMCPGV
PAVMSTLLANINAFYAHTTVATNVQVSASDRFAATNFGREKFIKLLDQLHNSLRIDLSKY
RENFPASNAERLQDLKSTVDLLTSITFFRMKVLELQSPPKASMVVKDCVRACLDSTYKYI
FDNCHELYSQLIDPSKKQDIPREDQGPTTKNLDFWPQLITLMVTIIDEDKTAYTPVLNQF
PQELNMGKISAEIMWTLFAQDMKYALEEHEKQRLCKSTDYMNLHFKVKWFYNEYVRELPA
FKDAVPEYSLWFEPFVMQWLDENEDVSMEFLHGALGRDKKDGFQQTSDHALFSCSVVDVF
AQLNQSFEIIKKLECPNPEALSHLMRRFAKTINKVLLQYAAIVSSDFSSYCDKENVPCIL
MNNIQQLRVQLEKMFESMGGKELDPEASAILKELQVKLNGVLDELSITYGESFQLIIEDC
IKQMSFELNQMRTNGNTASNKNSAAMDAEIVLRPLMDFLDKTLSLSAKICEKTVLKRVLK
ELWKLVLNKIEKQIVLPPLTDQTGPQMIFIAAKDLGQLSKLKEHMIREDAKGLTPRQCAV
MEVVLATIKQYFHAGGNGLKKNFLEKSPDLQSLRYALSLYTQTTDALIKKFIDTQTSQSR
PSKDSVGQISVHVDITTTPGTGEHKVTVKVIAINDLNWQTTAMFRPFVEVCILGPNLGDK
KRKQGTKTKSNTWSPKYNETFQFILGNENRPGAYELHLSVKDYCFAREDRIIGMTVIRLQ
NIAEKGSYGAWYPLLKNVSLDETGLTILRILSQRTNDDVAKEFVRLKSETRSAEETA
NT seq 6654 nt NT seq  +upstreamnt  +downstreamnt
atggtggctaatcttttcaagagcctgattttaccttacatacataagctttgcaaagga
atgtttacaaagaaactgggaaatacaaccaaanaaaaagagaatcgtcagcacaaaaag
gatcaagactttcctactgctggccagaccaaaacccctaaattttctaataccttaaaa
agcactgtaaagaagattgcgaagtgttcatctactcgcaacttatccactgaagaagac
gagactaataaagaattttccctctcaccaacattcagttaccgagtagctatcgccaat
ggcctacaaaagaatattaatgtaactaacagtgataatgaggatctgcttcaagagtta
tcttcgattgagagttcctattcagaatcactcaacgaactaaggagtagtacagaaaac
caggcacagtcaacacacacaatgccagttagacgcaatagaaagagttcaagcagcctg
gccccctctgagggcagttctgatggagaacgcactttacatagcttaaagctaggagct
ttacgcaaactgagaaaatggaaaaagagtcaggaatgtgtttcatcagattcagagttg
agcacaatgaagaaaacctggggaataagaagtaaatctttggacagaactgcacgaaac
ccaaagacaaatgccctcgagccaggattcagttcctctggctgcattagccaaacacat
gatgtcatggaaatgatctttaaggaacttcaggggataagtcagatcgaaacggaactc
tctgaactacgagggcatgtcaatgctctcaagcattctatagatgagatctccagcagt
gtggaggttgtacaaagtgaaattgagcagctacgtacagggtttgtccaatctcggagg
gaaaccagagacattcatgactatattaaacatttaggtcatatgggtagcaaggcaagc
ctgaggtttctaaatgtgcctgaagaaagatttgaatacattgaaagtgtggtgtatcaa
attctagtagataaaatgggcttttcagatgtaccaaatgcaattaaaattgaatttgct
caaaggataggacaccagagggactgcccaaatgcaaaacctcgacccatactcgtgtac
tttgaaacccctcagcaaagagattctgtattaaaaaaatcatacaaactcaaaggaaca
ggcattggaatctcaacagatattcttactcatgacataagagaaagaaaagaaagaggg
ataccatcctcccagacatatgaaagcatggatataaagctgtctactccagagcccaaa
agcaagaagaataattggcagtcacctgatgacagtgatggagagctggaatctgacctc
aatagaaatagttacgctgtgctttccaaatcagagtttccaacaaaaggaagtacttcc
aagtcaagttcaaaatcacacaattcaagagccaagaataaaactgctagtggcagcaga
atttcaagtaagtctgattatgataaaatttcctcacaattgccagaatcagataatttg
gaaaaacaaactacaacccattatgcagatgctacacccctctggcattcacagagtgat
tttttcactgctaaacttagtcgttctgaatcagatttttccaagttgtgtcaatcttac
tcagaggatttttcagaaaatcagtttttcactagaactaatggaagctccctcctgtca
tcttcagaccgagaactttggcagaggaagcaggagggcacagccaccttgtatgacagt
cctcagaatcaacatttgaaaggggcacttcagggtgcccaagggcagagtgaaattgag
aacacagaaactgtggatagtggaatgagtaatggtatggtatgtgcatctggggaccga
agtcattacagtgattctcagctctctttacatgaggatctttctccgtggaaggaatgg
aatcaagtagagcaaggcactgatttaggtttagattcatccacccaggaagcttttgac
tatgacacaaacagtctatctgatcaacaactagatgtttacaataaagacctagaagac
ttgggaaagggccacagtgactttcaggatgactctgagagctatgatttaacccaagat
gacaattcatctccatgccctgggttggataatgaaccacaaggccagtgggttggccaa
tatgattcttaccaggaagcaaattctaatgatctgtaccaaaatcaaaaccaattgtcc
atgatgtatcgaagtcaaagtgaattgcaaagcgatgattcagaggatgccccacccaaa
tcttggcatagtcgattaagtattgacctttctgataagtctttcagtttcccaaaattt
ggatctacattacagagagctaaatcagcattggaagtggtatggaacaaaagcacacag
agtcttagtgggtatgaagatagtggctcttccttaatggggagatttcggacattatcc
caatcaactgcaaatgagtcaagtaccacccttgattctgatgtctacacagagcctttt
tactacaaagcagaggatgaggaggactatagtgaaccagtggctgataatgagacagat
tatgttgaagtgatggagcaagtccttgcaaagctagaaaacaggactagtatgactgaa
acagatgaacaaatgcaggtatacgatcatccttcatatgaaacaccttatgaaacccca
caagatgagggttatgacgtgcaggcagatgatatggttagtgaaggaggattggagcca
ttaaatgaaacatcagctgaaatggaaataaaagaagatgaaaaccaaaacatccctgaa
cagcccatggaaatcataaagccaaagagaattcgtccttctttcaaagaagcagcttta
aaagcctataagaaacaaatggcagaattagaagagaagatcctggctggagatagcagt
tctgtggatgaaaaggctcgaatagtaagtggcaatgatttggaggctgccaaattctct
ggactccaggcgattggtggggctgggcgagggctttatggtattgacagtatgccagat
ctccgtaggaagaaaactttgcccattgtacgagatgtggccatgactctggctgcccgg
aaatctggactctccctggctatggtcattaggacatctctaaacaatgaggaactgaaa
atacatgtcttcaagaagaccttgcaggcactgatctaccccatgtcctccaccacccct
cacaattttgaggtctggacggcaacaacacccacctactgttacgagtgtgaagggctc
ctgtggggcattgcccggcaaggcatgaagtgtttggagtgtggagtgaaatgccatgaa
aagtgtcaggacctcctaaatgctgactgtttacagagagcagcagaaaagagttctaag
catggtgccgaagacaagacacagaccatcattacagctatgaaagaaagaatgaagatt
agggagaaaaacaggccagaggtgtttgaagtaattcaggaaatgtttcagatttctaaa
gaagatttcgtgcagtacacaaaagcggccaagcagagtgtactggatgggacatctaag
tggtcagcaaaaataaccattacagtggtttctgcacaaggcttgcaggcaaaagacaaa
acagggtctagtgacccatatgttactgttcaagttggaaagaacaaaagaagaactaaa
accatttttggaaacttgaatccagtatgggatgagaagttttattttgagtgccataac
tccacagatcgaatcaaagtcagagtgtgggatgaagatgatgacattaaatccagagtc
aagcagcatttcaaaaaggagtcagatgattttttgggacaaacaattgtagaagtgagg
accctgagtggagagatggatgtctggtacaacttagagaaacggacagataagtcagct
gtatctggggccataagattgaaaatcaatgtggagataaaaggagaggagaaggttgcc
ccatatcatatacaatatacatgtttacatgagaatctgttccattacttgactgaagtg
aagtctaatggtggagtgaaaataccagaggtcaaaggggaggaagcctggaaggttttc
tttgatgatgcttcccaagaaatagtcgatgaatttgccatgcgttacgggattgaatcc
atttatcaagctatgacgcacttttcatgtctgtcttctaaatacatgtgccctggtgtc
cctgctgtcatgagcaccttgttggcgaatataaatgctttctatgctcacacaacagtt
gcaacaaatgtacaggtttctgcctcagatcgatttgctgctaccaactttggtagggaa
aaattcataaaactattggaccagttgcataactctttaaggattgacctgtcaaagtat
agggaaaacttcccagccagcaatgctgaacgactgcaagacctgaaatcaactgttgac
ctactaacaagcatcaccttcttcaggatgaaggttctggagctgcaaagtcccccaaag
gccagcatggtggtgaaggactgtgttagggcgtgcctggattctacatacaagtatatt
tttgacaattgccatgaactctattctcaactaattgatccgagtaagaaacaggacatt
cctcgggaagatcagggaccaaccaccaagaatttggatttttggccccagcttattaca
ctgatggtcactattattgatgaggataaaactgcctacacaccagtcctgaatcagttt
cctcaagagctgaacatgggaaaaataagcgctgaaattatgtggaccctttttgctcag
gatatgaaatatgcattagaagaacatgagaagcagcggttatgcaagagcaccgattat
atgaatttgcatttcaaagtgaaatggttttataatgaatacgtgcgagagcttcctgcc
ttcaaggatgctgtccctgaatattccttgtggtttgagccttttgtcatgcagtggcta
gatgaaaatgaagatgtatcaatggagtttcttcatggagcactaggaagagacaaaaaa
gatggattccagcagacgtctgatcatgccctcttctcttgttctgtggttgatgtcttt
gctcagcttaaccagagctttgagattattaagaaactggagtgccctaatcctgaagca
ttatctcacttaatgagaagatttgcaaagactatcaataaagtactgcttcagtatgct
gcgattgtatcgagtgatttcagttcatactgcgataaggaaaatgtgccctgtatattg
atgaacaatattcaacaattgcgggtccagctggaaaaaatgtttgaatccatgggaggg
aaagagctagatcctgaagctagtgctattctaaaagaacttcaagttaaactcaatggg
gttctggatgagctcagcatcacttatggtgaaagtttccagcttatcattgaagactgt
ataaaacagatgagttttgaactaaaccaaatgagaacaaatggaaatactgcatctaat
aagaacagtgcagcaatggatgcagagattgtgttaagacccctcatggacttcttggac
aaaacattaagtctctcagcaaaaatctgtgaaaaaaccgtcctaaaacgagttttaaag
gagttatggaagctagttcttaacaaaatagaaaaacaaattgtcctccctcctctgaca
gatcaaacaggacctcagatgattttcattgcagctaaagatcttggacaattatccaaa
ctgaaggagcacatgattcgggaggatgccaagggtctgacaccaagacagtgtgctgtg
atggaggtggtcctggctactatcaagcaatactttcatgcaggaggaaatggcctgaaa
aagaatttcttggagaaaagcccagatcttcagtctctgagatatgctctcagtctttat
acccagacaactgatgccttgataaagaaattcatagacactcagacctcacagagtcgc
ccctcgaaagattcagtgggtcagatttctgttcatgtggacatcaccactaccccagga
actggagagcataaagtcactgtaaaagtgattgctattaatgatcttaactggcagacc
actgcaatgttcaggccctttgtggaagtttgtatactgggacccaaccttggagacaag
aagaggaaacaaggcacaaagacaaaaagcaacacatggtcacccaagtacaatgaaaca
tttcaattcattctaggtaatgaaaaccggccaggggcttatgaacttcatctatcagtt
aaagattactgctttgcccgagaagatagaattatcggaatgacggtaattcggctacag
aacatagcagaaaaaggaagctacggggcatggtatccccttctgaaaaatgtctccctg
gatgaaactggtttgactatccttagaatactctctcagaggaccaacgatgacgtggct
aaagaatttgtaagactgaaatctgaaaccagatctgctgaagagactgcttaa

DBGET integrated database retrieval system