KEGG   Felis catus (domestic cat): 101087568Help
Entry
101087568         CDS       T02385                                 

Gene name
PDIA4
Definition
protein disulfide isomerase family A, member 4
Orthology
K09582  
protein disulfide-isomerase A4 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Protein processing in endoplasmic reticulum
Thyroid hormone synthesis
Class
Genetic Information Processing; Folding, sorting and degradation; Protein processing in endoplasmic reticulum [PATH:fca04141]
Organismal Systems; Endocrine system; Thyroid hormone synthesis [PATH:fca04918]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
A2
AA seq 645 aa AA seqDB search
MRPRKACLLVLLLALAQLLAVASAGGPDEDSSNKEDAIEDEEEEEDDDDDEEEDDLEVKE
ENGVLILNDANFDNFVADKDTVLLEFYAPWCGHCKQFAPEYEKIANALKENDPPIPVAKI
DATSESTLASRFGVSGYPTIKVLKKGQAVDYEGSRTQEEIVAKVKEISQPNWTPPPEVTL
VLTKDNFDEVVNDADIILVEFYAPWCGHCKKLAPEYEKAAKELSQRSPPIPLAKVDATAE
TDLAKRFDVSSYPTLKIFRKGKPFDYNGPREKYGIVDYMIEQSGPPSKAIVALKQVQEFL
KDGDDVIIIGVFTAESDPAYQQYQEAANNLREDYKFHHTFSTEIAKFLKVSSGKLVVMQP
EKFQSKFEPRSYVMEIQSTTEGSAIRDHVLKHTLPLVGHRKTSNDAKRYTRRPLVVVYYS
VDFSFDYRAATQFWRNKVLEVAKDFPEYTFAVADEDDFATEVKDLGLSESGEDVNAAILD
EGGRKFAMEPDEFDSDTLREFVRAFKKGKLKPVVKSQPVPKNNKGPVKVVVGKTFDSIVM
DPKKDVLIEFYAPWCGHCKQLEPEYTALGKKYKGHKNLVIAKMDATANDIPNNRYKVEGF
PTIYFAPSGDKKNPIKFEDGNRDLEHLSKFVEEHATKLSRTREEL
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atgaggccccggaaagcctgcctgctggtgctgctcctggcgctggcgcagctgctggcg
gtggcgagcgccggggggccggacgaagattcttctaataaggaagatgccattgaggat
gaagaggaggaggaggacgacgacgacgatgaggaggaagacgacttggaagtgaaggaa
gaaaatggggtcctgatcctgaacgacgcaaactttgataactttgtggctgacaaagac
acggtgctgctggagttctatgctccatggtgtggacattgcaagcagtttgctccagaa
tatgaaaaaatcgccaatgccttgaaggagaacgaccctcccattcctgtggccaagatt
gacgcgacctcggagtcgacgctggccagcaggtttggcgtgagcggctaccccaccatc
aaggtccttaagaaggggcaggctgtggactacgagggctcccggacccaggaagaaatt
gtggccaaggtcaaagagatctcccagcccaactggacgccgccaccagaagtcacgctt
gtgctgaccaaggataacttcgatgaagtggtgaacgatgcagacatcattctggtggag
ttctatgccccctggtgtggacactgcaagaaactggcccccgagtatgagaaggcggcc
aaggagctgagccagcgttcccccccgatccccctggccaaggtcgacgccactgccgaa
acagacctggccaagaggttcgacgtctctagctatcccaccctgaaaatcttccgcaag
ggaaaaccctttgattacaacggcccacgggaaaaatacgggatcgtggactacatgatc
gagcagtcggggccgccctccaaggcgatcgtggctctgaagcaggtgcaggagttcctg
aaggacggggacgatgtcatcatcatcggggtctttacagcggagagtgacccggcctac
cagcagtaccaggaagctgccaacaacctaagagaagattacaaattccaccacactttc
agcactgaaatagcaaagttcttgaaagtctcctctgggaagttggttgtaatgcagcct
gagaaattccagtccaaattcgagcccagaagctacgtgatggagatccagagcaccacc
gaggggtcagccatcagggaccacgtgttgaagcacaccttgcccctggtgggccatcgc
aagacctccaatgacgccaagcggtacacgcggcgccccctggtggtcgtctactacagc
gtggacttcagctttgattacagagctgccactcagttttggcggaataaggtcctggag
gtggccaaggacttccccgagtacaccttcgccgtggctgatgaggatgactttgccacg
gaggtgaaggacctggggctcagcgagagcggcgaggacgtcaacgcagccatcctggac
gagggcgggcggaagttcgccatggagcccgacgagtttgactctgacaccctccgtgag
ttcgtcagagctttcaaaaaaggaaaactaaagccggttgtcaagtcccagccggtgccc
aagaacaacaagggacctgtcaaggtcgtggtggggaagacgtttgactccatcgtgatg
gaccccaagaaggacgtcctcatcgaattctacgcgccctggtgcgggcactgcaagcag
ctggagcccgagtataccgccctcggcaagaagtacaagggccacaagaatctggtcatc
gccaagatggacgccaccgccaacgacatccccaacaaccgctacaaagtcgaggggttc
ccgaccatctactttgcccccagcggggacaaaaagaacccgataaagtttgaggatgga
aaccgagatctggaacatttgagcaagtttgtagaagaacacgccacaaaactgagcagg
accagggaggagctttga

DBGET integrated database retrieval system