KEGG   Felis catus (domestic cat): 101087662Help
Entry
101087662         CDS       T02385                                 

Definition
UDP-glucuronosyltransferase 2C1-like
Orthology
K00699  
glucuronosyltransferase [EC:2.4.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Pentose and glucuronate interconversions
Ascorbate and aldarate metabolism
Steroid hormone biosynthesis
Starch and sucrose metabolism
Retinol metabolism
Porphyrin and chlorophyll metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Drug metabolism - other enzymes
Metabolic pathways
Chemical carcinogenesis
Module
Glucuronate pathway (uronate pathway)
Ascorbate biosynthesis, animals, glucose-1P => ascorbate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    101087662
   00053 Ascorbate and aldarate metabolism
    101087662
   00500 Starch and sucrose metabolism
    101087662
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101087662
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101087662
   00860 Porphyrin and chlorophyll metabolism
    101087662
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101087662
   00982 Drug metabolism - cytochrome P450
    101087662
   00983 Drug metabolism - other enzymes
    101087662
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101087662
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.17  glucuronosyltransferase
     101087662
Glycosyltransferases [BR:fca01003]
 Others
  Hydrophobic molecule
   101087662
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B1
AA seq 529 aa AA seqDB search
MRTVKGFWVLFMLHLYFFDSGRTGKILVWPLDFSHWINLKVILDQLQLRGHEVTVLVPSP
SYLFDHTKIPFNVEILQLPVTKETLMEELSGILYDVSFELPKLSWWSMQGKLTELVYKFS
RTAKRMCESAITNKELLSRLQATKFDICLADPLSFCGELLAELLNIPFVYSFRFSYGNVI
ERLCAQLPIPSSYVPGITLGLTDRMTFVQRLENWLLYIVTDIMFLYFVFPEWDDYYSKAL
GKPATLCEIMGKAEMWLIRTYWDIEFPYPYLPNIEFVGGLHCKPAKPLPKELEEFVQSSG
KDGVVVFTLGSMIKNLTEEKSNLIASALAQIPQKVLWRYTGKKPDTLGPNTRLYEWIPQN
DLLGHPKTRAFITHCGTNGIYEAIYHGVPMVGIPIFGDQYDNIARMKAKGAALKVDLHTM
TSSDLLNALKAVINNPFYKENAMRLSRIHHDQPTKPLDRAVFWIEFVMRHKGAKHLRPTS
HDLTWVQYHSLDVIGFLLACVATTIFLVTKCCLFCCWKCGKTGKKNKRE
NT seq 1590 nt NT seq  +upstreamnt  +downstreamnt
atgaggactgtaaaaggtttctgggttcttttcatgctgcatctgtatttcttcgactct
ggaaggactgggaaaatacttgtgtggcccttggattttagtcactggattaatttaaaa
gttatcctggatcaactccagcttcgtgggcatgaggtaactgtcctggtaccttcacca
agttatctgtttgatcataccaagattccctttaatgtggagatccttcaacttccagta
actaaagaaactctcatggaagagctcagtggtatcctctatgatgtttcctttgaactg
ccaaaactttcatggtggagcatgcaaggaaaactgacagaacttgtctacaagttttct
aggacagccaaaagaatgtgtgagagtgctatcacaaataaggagttactcagcaggcta
caagcaactaagtttgatatctgtttagctgatcccttaagcttttgtggggaattgttg
gctgagctcctcaatattccatttgtatactcttttcgattttcttatgggaatgtcatt
gagagactgtgtgctcagcttcctatcccttcttcatatgttcctggcatcacattagga
ttgacagaccgcatgacttttgtacagagactagagaattggttactgtacatagtgact
gatattatgtttttatattttgtatttccagaatgggatgactattacagcaaggcttta
ggaaaacctgccacattatgtgagattatggggaaagctgaaatgtggttgattcgaact
tactgggatattgaatttccttacccttatttacctaacattgaatttgttggaggactg
cactgcaagcctgcaaagcccctgccgaaggagttagaagagtttgtccaaagctctgga
aaggatggagttgtggtatttactctgggttcaatgatcaaaaacctcacagaagaaaag
tctaatctaattgcatcagcccttgcccagattccacagaaggttctgtggagatacaca
ggaaagaaaccagatacgttaggacccaatacccggctatatgaatggattccccagaat
gatcttcttggtcatcccaagaccagagcttttatcactcactgtggaaccaatgggatc
tatgaagctatttaccatggggtccctatggtgggaattcccatatttggtgatcagtat
gataatattgctcgtatgaaagccaaaggggcagctcttaaagtagacttacatacaatg
acaagttccgatctacttaacgctttgaaggcagttattaacaaccctttctataaagag
aacgctatgaggttatcaagaattcaccatgatcagcctacaaagcccttggatcgagca
gtcttctggatcgagtttgtcatgcgccacaaaggagccaaacaccttcggccaacctcc
catgacctcacctgggtccagtaccactcgttggatgtgattgggttcctgctggcctgt
gtggctactactatattcctggtcacaaaatgttgcctgttttgttgctggaaatgtggt
aagacagggaagaagaacaagagagaatag

DBGET integrated database retrieval system