KEGG   Felis catus (domestic cat): 101087726Help
Entry
101087726         CDS       T02385                                 

Gene name
GSTK1
Definition
glutathione S-transferase kappa 1
Orthology
K13299  
glutathione S-transferase kappa 1 [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Peroxisome
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fca00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:fca00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:fca00982]
Cellular Processes; Transport and catabolism; Peroxisome [PATH:fca04146]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:fca05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A2
AA seq 226 aa AA seqDB search
MTPAPRTLELFYDVLSPYSWLGFEVLCRYKKLWNINLQLRPSLIAAIMKDSGNQPPALLP
RKAQYLQNDIRLLGQQIQVPIQFPKDFFSVILEKGSLSAMRFLTAVNLEHPKMLEKVSRE
LWMRVWSRDEDISEPKSILAAAEKAGMSTEQAQGLLEKISTPKVKNELRDTTNAACKYGA
FGLPVTVAHLDGQTHMLFGSDRMELLAHLLGEKWMGPVPPAINAKI
NT seq 681 nt NT seq  +upstreamnt  +downstreamnt
atgacgcccgcgccgcgcactctggagctcttctacgatgtgctctccccctactcctgg
ttgggcttcgaggtcctgtgccgatataagaagctctggaacatcaacctgcagttgcgc
ccgagcctcattgcagcgatcatgaaagacagcggaaaccagccgccagctctgcttccc
cgcaaagcccaatacctgcaaaatgacatcaggctcctgggacagcagatccaggttccc
atccagttccccaaggatttcttctctgtgatccttgaaaaaggaagtttatcagccatg
cgattcctcaccgctgtgaacctggagcacccaaagatgctggagaaagtgtccagagaa
ctatggatgcgcgtctggtcacgagatgaagacatctcggagcccaagagcatcctggct
gctgcagagaaagctggcatgtctacagaacaagcccagggacttctggaaaagatctca
acaccaaaggtgaagaacgagctcagggataccaccaacgcagcctgcaaatacggggcc
tttgggctgcctgtcaccgtggcccatctggatggccaaacccacatgctgtttggctct
gaccggatggagttgctggcacacctgctgggagagaagtggatgggccctgtgcctcca
gccataaatgccaaaatttaa

DBGET integrated database retrieval system