KEGG   Felis catus (domestic cat): 101087777Help
Entry
101087777         CDS       T02385                                 

Gene name
PLCD1
Definition
(RefSeq) phospholipase C, delta 1
  KO
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101087777 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101087777 (PLCD1)
   04070 Phosphatidylinositol signaling system
    101087777 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101087777 (PLCD1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101087777 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C2
AA seq 777 aa AA seqDB search
MQCLGIRSRTRSRELYLQEQSLKVAALNGQRLGLQDDEDLQVLLKGSQLLKVKSNSWRRE
RFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKYARDVPEDRCFSI
VFKDQRNTLDLIAPSPADARHWVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNK
MSFKELQNFLKELNIQVDDSYARRIFRECDRSQTDSLEDEEIEAFYKMLTQREEIDRTFA
EAAGSRETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYL
LSADGSAFSLAHRRVYQDMGQPLSHYLMSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRC
LELDCWDGPNLEPIIYHGYTFTSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQR
VMARHLRTILGPMLLDRPLDGATTSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVV
SDEDEAAEMEDEAVRSRVQHKPREDKLRLVKELSDMVIYCKSVHFGGFSGPGTPGQAFYE
MVSFSENRALRLLQESGNSFVRHNVTHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNF
QTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNSTFNSRALAQGPWWTRKRLSVRVISGQ
QLPKVNKNKNSIVDPKVTVEIHGVGRDTASRQTAVVTNNGFNPWWDTEFEFEVVVPELAL
VRFLVEDYDASSKNDFIGQSTIPLGSLKQGYRHVHLLSKNGDQHPSATLFVKVSLQD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcctaggaatccgcagccggacccgctccagagagctctacctgcaggagcag
agcctcaaggtggcagcgctcaacgggcagaggctgggcctacaggatgatgaggaccta
caggtactgctgaagggcagccagctcctgaaggtgaagtccaactcatggcggagggag
cgtttctacaagttgcaggaagactgcaagaccatctggcaggagtcccgcaaggtcatg
cggaccccagagtcccagctgttctccattgaggacattcaggaggtgcggatggggcac
cgcacggagggcctggagaagtatgcccgcgacgtgcccgaggaccgctgcttctccatc
gtcttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgacgcccgg
cactgggtgcagggtctgcgcaagatcatccaccactcgggctccatggaccagcggcag
aagctgcagcactggattcactcttgcttgcgaaaagctgacaaaaacaaggacaacaag
atgagcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagc
tatgcccggaggatcttcagggaatgtgaccgctcccagacagactcgctggaggatgag
gagatcgaggccttctacaagatgctgacccagcgggaggagattgaccgcacctttgcg
gaggccgcaggctccagggagacgctgtcggtggatcagttagtgacgttcctgcagcac
cagcagcgggaggaggcggcggggcctgcgctggccctctctctcattgagcgctatgaa
cccagcgagacggccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacctg
ctgtccgccgacggcagcgccttcagcctggcgcatcggcgggtctaccaggacatgggc
cagccgctcagccactacctgatgtcctcctcgcacaacacctacctgctggaagaccag
ctcaccgggcccagcagcaccgaagcctacatccgggcgctgtgcaagggctgccgctgc
ctggagctcgactgctgggacggccccaacctggagccgatcatctaccacggctacacg
ttcacctccaagatcctcctctgcgacgtgctcagggctatcagggactacgccttcaag
gcgtccccctaccccgtcatcctgtccctggagaaccattgcagcctggagcaacagcgt
gtgatggcgcgacacctgcgcaccatcctgggccccatgctcttggaccggccgctggac
ggggccactaccagcctgccttcccctgagcaactgaaggggaagatcttgctgaagggg
aagaagcttggggggctcctgccccctggcggggagggtggccctgaagccactgtcgtg
tctgatgaggatgaggctgctgagatggaggacgaggcagtgaggagccgagtgcagcac
aagcccagggaggacaagctcaggctagtgaaggagctctccgatatggtcatttactgc
aagagtgtccactttgggggcttctccggccccggcaccccagggcaggctttctatgag
atggtgtccttctctgagaaccgcgccctccgactgctccaagagtcaggaaacagcttt
gttcgccacaatgtgactcacctgagcaggatctaccctgctgggtggagaacggactcc
tccaactacagccccgtggagatgtggaacgggggctgccagattgtggccctcaatttc
cagacacctggcccagagatggatgtgtaccagggccgcttccaggacaacggggcctgc
gggtacgtgctgaagcctgccttcctgcgagacccgaactcgacctttaactcgcgtgct
ctggctcaggggccctggtggacccggaagcggctcagtgtcagggtcatctccgggcag
cagctgccaaaagtcaacaagaataagaattcaatcgtggaccccaaggtgacggtggag
atccacggcgtgggccgggacacggcgagccgccagacggctgtggtcaccaataacggt
ttcaacccgtggtgggacacagagtttgagttcgaggtggttgtgcctgagctcgccctc
gtgcgcttcttggtggaggattatgacgcctcctctaagaacgacttcattggccagagc
accatccccttgggcagcctcaagcagggataccgccacgtccacctcttgtccaagaac
ggagaccagcacccttctgccaccctctttgtgaaggtgtctctccaggactag

DBGET integrated database retrieval system