KEGG   Felis catus (domestic cat): 101087777Help
Entry
101087777         CDS       T02385                                 

Gene name
PLCD1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase delta-1 isoform X3
  KO
K05857  phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04020  Calcium signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101087777 (PLCD1)
 Environmental Information Processing
  Signal transduction
   04020 Calcium signaling pathway
    101087777 (PLCD1)
   04070 Phosphatidylinositol signaling system
    101087777 (PLCD1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101087777 (PLCD1)
 Human Diseases
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101087777 (PLCD1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101087777 (PLCD1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101087777 (PLCD1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101087777 (PLCD1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y EF-hand_like EF-hand_10 C2 PH_12 PH EF-hand_1 EF-hand_6 EF-hand_7 EF-hand_5 SPARC_Ca_bdg TEP1_N
Motif
Other DBs
NCBI-GeneID: 101087777
NCBI-ProteinID: XP_011284537
Ensembl: ENSFCAG00000002286
Position
C2
AA seq 777 aa AA seqDB search
MQCLGIRSRTRSRELYLQEQSLKVAALNGQRLGLQDDEDLQVLLKGSQLLKVKSNSWRRE
RFYKLQEDCKTIWQESRKVMRTPESQLFSIEDIQEVRMGHRTEGLEKYARDVPEDRCFSI
VFKDQRNTLDLIAPSPADARHWVQGLRKIIHHSGSMDQRQKLQHWIHSCLRKADKNKDNK
MSFKELQNFLKELNIQVDDSYARRIFRECDRSQTDSLEDEEIEAFYKMLTQREEIDRTFA
EAAGSRETLSVDQLVTFLQHQQREEAAGPALALSLIERYEPSETAKAQRQMTKDGFLMYL
LSADGSAFSLAHRRVYQDMGQPLSHYLMSSSHNTYLLEDQLTGPSSTEAYIRALCKGCRC
LELDCWDGPNLEPIIYHGYTFTSKILLCDVLRAIRDYAFKASPYPVILSLENHCSLEQQR
VMARHLRTILGPMLLDRPLDGATTSLPSPEQLKGKILLKGKKLGGLLPPGGEGGPEATVV
SDEDEAAEMEDEAVRSRVQHKPREDKLRLVKELSDMVIYCKSVHFGGFSGPGTPGQAFYE
MVSFSENRALRLLQESGNSFVRHNVTHLSRIYPAGWRTDSSNYSPVEMWNGGCQIVALNF
QTPGPEMDVYQGRFQDNGACGYVLKPAFLRDPNSTFNSRALAQGPWWTRKRLSVRVISGQ
QLPKVNKNKNSIVDPKVTVEIHGVGRDTASRQTAVVTNNGFNPWWDTEFEFEVVVPELAL
VRFLVEDYDASSKNDFIGQSTIPLGSLKQGYRHVHLLSKNGDQHPSATLFVKVSLQD
NT seq 2334 nt NT seq  +upstreamnt  +downstreamnt
atgcaatgcctaggaatccgcagccggacccgctccagagagctctacctgcaggagcag
agcctcaaggtggcagcgctcaacgggcagaggctgggcctacaggatgatgaggaccta
caggtactgctgaagggcagccagctcctgaaggtgaagtccaactcatggcggagggag
cgtttctacaagttgcaggaagactgcaagaccatctggcaggagtcccgcaaggtcatg
cggaccccagagtcccagctgttctccattgaggacattcaggaggtgcggatggggcac
cgcacggagggcctggagaagtatgcccgcgacgtgcccgaggaccgctgcttctccatc
gtcttcaaggaccagcgcaatacactagacctcatcgccccatcgccagctgacgcccgg
cactgggtgcagggtctgcgcaagatcatccaccactcgggctccatggaccagcggcag
aagctgcagcactggattcactcttgcttgcgaaaagctgacaaaaacaaggacaacaag
atgagcttcaaggagctgcagaacttcctgaaggagctcaacatccaggtggacgacagc
tatgcccggaggatcttcagggaatgtgaccgctcccagacagactcgctggaggatgag
gagatcgaggccttctacaagatgctgacccagcgggaggagattgaccgcacctttgcg
gaggccgcaggctccagggagacgctgtcggtggatcagttagtgacgttcctgcagcac
cagcagcgggaggaggcggcggggcctgcgctggccctctctctcattgagcgctatgaa
cccagcgagacggccaaggcgcagcggcagatgaccaaggacggcttcctcatgtacctg
ctgtccgccgacggcagcgccttcagcctggcgcatcggcgggtctaccaggacatgggc
cagccgctcagccactacctgatgtcctcctcgcacaacacctacctgctggaagaccag
ctcaccgggcccagcagcaccgaagcctacatccgggcgctgtgcaagggctgccgctgc
ctggagctcgactgctgggacggccccaacctggagccgatcatctaccacggctacacg
ttcacctccaagatcctcctctgcgacgtgctcagggctatcagggactacgccttcaag
gcgtccccctaccccgtcatcctgtccctggagaaccattgcagcctggagcaacagcgt
gtgatggcgcgacacctgcgcaccatcctgggccccatgctcttggaccggccgctggac
ggggccactaccagcctgccttcccctgagcaactgaaggggaagatcttgctgaagggg
aagaagcttggggggctcctgccccctggcggggagggtggccctgaagccactgtcgtg
tctgatgaggatgaggctgctgagatggaggacgaggcagtgaggagccgagtgcagcac
aagcccagggaggacaagctcaggctagtgaaggagctctccgatatggtcatttactgc
aagagtgtccactttgggggcttctccggccccggcaccccagggcaggctttctatgag
atggtgtccttctctgagaaccgcgccctccgactgctccaagagtcaggaaacagcttt
gttcgccacaatgtgactcacctgagcaggatctaccctgctgggtggagaacggactcc
tccaactacagccccgtggagatgtggaacgggggctgccagattgtggccctcaatttc
cagacacctggcccagagatggatgtgtaccagggccgcttccaggacaacggggcctgc
gggtacgtgctgaagcctgccttcctgcgagacccgaactcgacctttaactcgcgtgct
ctggctcaggggccctggtggacccggaagcggctcagtgtcagggtcatctccgggcag
cagctgccaaaagtcaacaagaataagaattcaatcgtggaccccaaggtgacggtggag
atccacggcgtgggccgggacacggcgagccgccagacggctgtggtcaccaataacggt
ttcaacccgtggtgggacacagagtttgagttcgaggtggttgtgcctgagctcgccctc
gtgcgcttcttggtggaggattatgacgcctcctctaagaacgacttcattggccagagc
accatccccttgggcagcctcaagcagggataccgccacgtccacctcttgtccaagaac
ggagaccagcacccttctgccaccctctttgtgaaggtgtctctccaggactag

DBGET integrated database retrieval system