KEGG   Felis catus (domestic cat): 101087958Help
Entry
101087958         CDS       T02385                                 

Gene name
MAPK3
Definition
mitogen-activated protein kinase 3
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
fca  Felis catus (domestic cat)
Pathway
MAPK signaling pathway
ErbB signaling pathway
Ras signaling pathway
Rap1 signaling pathway
cGMP-PKG signaling pathway
cAMP signaling pathway
Chemokine signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Oocyte meiosis
mTOR signaling pathway
PI3K-Akt signaling pathway
Adrenergic signaling in cardiomyocytes
Vascular smooth muscle contraction
Dorso-ventral axis formation
TGF-beta signaling pathway
Axon guidance
VEGF signaling pathway
Osteoclast differentiation
Focal adhesion
Adherens junction
Gap junction
Platelet activation
Toll-like receptor signaling pathway
NOD-like receptor signaling pathway
Natural killer cell mediated cytotoxicity
T cell receptor signaling pathway
B cell receptor signaling pathway
Fc epsilon RI signaling pathway
Fc gamma R-mediated phagocytosis
TNF signaling pathway
Circadian entrainment
Long-term potentiation
Neurotrophin signaling pathway
Retrograde endocannabinoid signaling
Glutamatergic synapse
Cholinergic synapse
Serotonergic synapse
Long-term depression
Regulation of actin cytoskeleton
Insulin signaling pathway
GnRH signaling pathway
Progesterone-mediated oocyte maturation
Estrogen signaling pathway
Melanogenesis
Prolactin signaling pathway
Thyroid hormone signaling pathway
Oxytocin signaling pathway
Type II diabetes mellitus
Aldosterone-regulated sodium reabsorption
Alzheimer's disease
Prion diseases
Alcoholism
Salmonella infection
Pertussis
Leishmaniasis
Chagas disease (American trypanosomiasis)
Toxoplasmosis
Tuberculosis
Hepatitis C
Hepatitis B
Influenza A
Pathways in cancer
Viral carcinogenesis
Proteoglycans in cancer
Colorectal cancer
Renal cell carcinoma
Pancreatic cancer
Endometrial cancer
Glioma
Prostate cancer
Thyroid cancer
Melanoma
Bladder cancer
Chronic myeloid leukemia
Acute myeloid leukemia
Non-small cell lung cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101087958 (MAPK3)
   04015 Rap1 signaling pathway
    101087958 (MAPK3)
   04010 MAPK signaling pathway
    101087958 (MAPK3)
   04012 ErbB signaling pathway
    101087958 (MAPK3)
   04350 TGF-beta signaling pathway
    101087958 (MAPK3)
   04370 VEGF signaling pathway
    101087958 (MAPK3)
   04668 TNF signaling pathway
    101087958 (MAPK3)
   04066 HIF-1 signaling pathway
    101087958 (MAPK3)
   04068 FoxO signaling pathway
    101087958 (MAPK3)
   04024 cAMP signaling pathway
    101087958 (MAPK3)
   04022 cGMP - PKG signaling pathway
    101087958 (MAPK3)
   04151 PI3K-Akt signaling pathway
    101087958 (MAPK3)
   04150 mTOR signaling pathway
    101087958 (MAPK3)
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101087958 (MAPK3)
  Cell growth and death
   04114 Oocyte meiosis
    101087958 (MAPK3)
  Cell communication
   04510 Focal adhesion
    101087958 (MAPK3)
   04520 Adherens junction
    101087958 (MAPK3)
   04540 Gap junction
    101087958 (MAPK3)
 Organismal Systems
  Immune system
   04611 Platelet activation
    101087958 (MAPK3)
   04620 Toll-like receptor signaling pathway
    101087958 (MAPK3)
   04621 NOD-like receptor signaling pathway
    101087958 (MAPK3)
   04650 Natural killer cell mediated cytotoxicity
    101087958 (MAPK3)
   04660 T cell receptor signaling pathway
    101087958 (MAPK3)
   04662 B cell receptor signaling pathway
    101087958 (MAPK3)
   04664 Fc epsilon RI signaling pathway
    101087958 (MAPK3)
   04666 Fc gamma R-mediated phagocytosis
    101087958 (MAPK3)
   04062 Chemokine signaling pathway
    101087958 (MAPK3)
  Endocrine system
   04910 Insulin signaling pathway
    101087958 (MAPK3)
   04912 GnRH signaling pathway
    101087958 (MAPK3)
   04915 Estrogen signaling pathway
    101087958 (MAPK3)
   04914 Progesterone-mediated oocyte maturation
    101087958 (MAPK3)
   04917 Prolactin signaling pathway
    101087958 (MAPK3)
   04921 Oxytocin signaling pathway
    101087958 (MAPK3)
   04919 Thyroid hormone signaling pathway
    101087958 (MAPK3)
   04916 Melanogenesis
    101087958 (MAPK3)
  Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101087958 (MAPK3)
   04270 Vascular smooth muscle contraction
    101087958 (MAPK3)
  Excretory system
   04960 Aldosterone-regulated sodium reabsorption
    101087958 (MAPK3)
  Nervous system
   04724 Glutamatergic synapse
    101087958 (MAPK3)
   04725 Cholinergic synapse
    101087958 (MAPK3)
   04726 Serotonergic synapse
    101087958 (MAPK3)
   04720 Long-term potentiation
    101087958 (MAPK3)
   04730 Long-term depression
    101087958 (MAPK3)
   04723 Retrograde endocannabinoid signaling
    101087958 (MAPK3)
   04722 Neurotrophin signaling pathway
    101087958 (MAPK3)
  Development
   04320 Dorso-ventral axis formation
    101087958 (MAPK3)
   04360 Axon guidance
    101087958 (MAPK3)
   04380 Osteoclast differentiation
    101087958 (MAPK3)
  Environmental adaptation
   04713 Circadian entrainment
    101087958 (MAPK3)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101087958 (MAPK3)
   05205 Proteoglycans in cancer
    101087958 (MAPK3)
   05203 Viral carcinogenesis
    101087958 (MAPK3)
   05210 Colorectal cancer
    101087958 (MAPK3)
   05212 Pancreatic cancer
    101087958 (MAPK3)
   05214 Glioma
    101087958 (MAPK3)
   05216 Thyroid cancer
    101087958 (MAPK3)
   05221 Acute myeloid leukemia
    101087958 (MAPK3)
   05220 Chronic myeloid leukemia
    101087958 (MAPK3)
   05218 Melanoma
    101087958 (MAPK3)
   05211 Renal cell carcinoma
    101087958 (MAPK3)
   05219 Bladder cancer
    101087958 (MAPK3)
   05215 Prostate cancer
    101087958 (MAPK3)
   05213 Endometrial cancer
    101087958 (MAPK3)
   05223 Non-small cell lung cancer
    101087958 (MAPK3)
  Neurodegenerative diseases
   05010 Alzheimer's disease
    101087958 (MAPK3)
   05020 Prion diseases
    101087958 (MAPK3)
  Substance dependence
   05034 Alcoholism
    101087958 (MAPK3)
  Endocrine and metabolic diseases
   04930 Type II diabetes mellitus
    101087958 (MAPK3)
  Infectious diseases
   05132 Salmonella infection
    101087958 (MAPK3)
   05133 Pertussis
    101087958 (MAPK3)
   05152 Tuberculosis
    101087958 (MAPK3)
   05164 Influenza A
    101087958 (MAPK3)
   05161 Hepatitis B
    101087958 (MAPK3)
   05160 Hepatitis C
    101087958 (MAPK3)
   05145 Toxoplasmosis
    101087958 (MAPK3)
   05140 Leishmaniasis
    101087958 (MAPK3)
   05142 Chagas disease (American trypanosomiasis)
    101087958 (MAPK3)
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.24  mitogen-activated protein kinase
     101087958 (MAPK3)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: CMGC group
  MAPK family [OT]
   101087958 (MAPK3)
Exosome [BR:fca04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   101087958 (MAPK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
E3
AA seq 415 aa AA seqDB search
MAGALGAWGQGEGGEAGKIRKKQIRRVLNSCLLEEFAPKTEKQGAWVAPCGALGDPTGSG
RGGETKYSWGGDIVSEERAKDPTLGRGCLGFSHSAYDHVRKTRVAIKKISPFEHQTYCQR
TLREIQILLRFRHENVIGIRDILRAPTLEAMRDVYIVQDLMETDLYKLLKSQQLSNDHIC
YFLYQILRGLKYIHSANVLHRDLKPSNLLINTTCDLKICDFGLARIADPEHDHTGFLTEY
VATRWYRAPEIMLNSKGYTKSIDIWSVGCILAEMLSNRPIFPGKHYLDQLNHILGILGSP
SQEDLNCIINMKARNYLQSLPSKTKVAWAKLFPKSDAKALDLLDRMLTFNPNKRITVEEA
LAHPYLEQYYDPTDEPVAEEPFTFDMELDDLPKERLKELIFQETARFQPGALEAP
NT seq 1248 nt NT seq  +upstreamnt  +downstreamnt
atggctggagccttgggggcttggggtcaaggggaaggcggtgaagctgggaagatccgc
aagaagcagatccggagggtcctcaactcatgtcttctcgaggagtttgctcccaagaca
gagaagcagggcgcctgggtggctccctgtggggccctcggggaccctacgggctcgggg
agaggcggagaaactaagtattcttggggaggtgatatcgtcagcgaagagcgagcgaag
gaccctactctggggagaggatgccttggattctcccactcagcttatgaccacgtgcgc
aagactcgcgtggccatcaagaaaatcagccccttcgagcatcagacctattgccagcgc
acactgcgggagatccagatcttgctgcgcttccgccatgagaacgtcattggcatccgg
gacattctgcgggcgcccaccctggaagccatgagggatgtctacattgtgcaggacctg
atggagacagacctgtacaagttgctcaaaagccagcagctgagcaacgaccacatttgc
tacttcctctaccagatcctgcggggcctcaagtatatccactcagccaacgtgctccac
cgggatttaaagccctctaacctgctcatcaacaccacctgcgaccttaagatctgtgat
tttggcctggcccggattgccgatcctgagcatgaccacactggcttcctgacagaatat
gtggccacacgctggtaccgggctccagaaatcatgcttaactccaagggctacaccaag
tccatcgacatctggtctgtgggctgcattctggctgagatgctctccaacaggcccatc
ttccctggcaagcactacctggaccagctcaaccacattctggggatcctgggctcccca
tcccaggaggacttgaattgtatcatcaacatgaaggcccgaaactacctacagtctctg
ccctccaagaccaaggtggcctgggccaagctttttcccaagtcagatgccaaagccctt
gatctgctagaccggatgttgacctttaaccccaacaaacggatcacagtggaggaagca
ctggctcacccctacctggagcagtactacgacccaacggatgagccagtggccgaggag
cctttcaccttcgacatggagctggatgatctacccaaggaacggctgaaggagctcatc
ttccaggagacagcccgcttccagcctggggcactggaggccccctaa

DBGET integrated database retrieval system