KEGG   Felis catus (domestic cat): 101087964Help
Entry
101087964         CDS       T02385                                 

Gene name
DHFR
Definition
dihydrofolate reductase
Orthology
K00287  
dihydrofolate reductase [EC:1.5.1.3]
Organism
fca  Felis catus (domestic cat)
Pathway
One carbon pool by folate
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    101087964 (DHFR)
   00670 One carbon pool by folate
    101087964 (DHFR)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.3  dihydrofolate reductase
     101087964 (DHFR)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A1
AA seq 187 aa AA seqDB search
MVRPLNCIVAVSQNMGIGKNGDLPWPPLRNEFKYFQRMTTTSSVEGKQNLVIMGRKTWFS
IPEKNRPLKDRINIVLSRDLKEPPQGAHFLAKSLDDALELTEQPELAHKVDMVWVVGGSS
VYKEAMNRPGHVRLFVTRIMQEFESDTFFPEIDLEKYKLLPEYPGVLSDIQEEKSIKYKF
EVYEKNN
NT seq 564 nt NT seq  +upstreamnt  +downstreamnt
atggttcgtccgctaaactgtatcgtcgctgtgtcccagaacatgggcatcggcaagaac
ggggacctgccctggccgccgctcaggaatgaattcaagtatttccaaaggatgaccaca
acctcatccgtagaaggtaaacagaatttggtgattatgggtagaaagacatggttctct
attccggagaagaatcgacctttaaaggacagaattaatatagttctcagtagagacctc
aaggaacctccacaaggagctcattttcttgccaaaagtctggatgatgccttagaactt
actgagcaaccagaattagcacataaagtggacatggtttgggtagtgggaggcagttct
gtttataaggaagccatgaacaggccaggccacgttagactatttgtgacaaggattatg
caggagtttgaaagtgacacattttttccagaaattgatttggagaaatataaacttctc
ccagaatacccaggtgttctttctgatatccaggaggagaaaagcattaagtacaaattt
gaagtatatgagaagaacaattaa

DBGET integrated database retrieval system