KEGG   Felis catus (domestic cat): 101088140Help
Entry
101088140         CDS       T02385                                 

Gene name
EIF4E1B
Definition
eukaryotic translation initiation factor 4E family member 1B
Orthology
K03259  
translation initiation factor 4E
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
HIF-1 signaling pathway
mTOR signaling pathway
PI3K-Akt signaling pathway
Insulin signaling pathway
Module
eIF4F complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101088140 (EIF4E1B)
 Environmental Information Processing
  Signal transduction
   04066 HIF-1 signaling pathway
    101088140 (EIF4E1B)
   04151 PI3K-Akt signaling pathway
    101088140 (EIF4E1B)
   04150 mTOR signaling pathway
    101088140 (EIF4E1B)
 Organismal Systems
  Endocrine system
   04910 Insulin signaling pathway
    101088140 (EIF4E1B)
Translation factors [BR:fca03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    101088140 (EIF4E1B)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A1
AA seq 224 aa AA seqDB search
MATASPVGEAEGGIQNWEEKEEKLSQRRKEAQDGGPQGIKLELHPLLNRWALWFFKNDRS
RAWXDNLHLVTKFDTVEDFWAMYSHIQLASKLSSGCDYALFKDGIEPMWEDSRNKRGGRW
LVSLAKQQRHSELDRLWLETLLCLIGESFEEHSREVCGAVINIRTKGDKIAVWTREAENQ
AGVLHIGRVYKERLGLSTKIVIGYQAHADTATKSNSLAKNKFVV
NT seq 675 nt NT seq  +upstreamnt  +downstreamnt
atggctactgctagccctgttggagaggctgagggtggaatccaaaactgggaggagaag
gaggagaaactgtcccagaggaggaaggaagcccaggatgggggcccccaggggatcaag
ttggagttgcacccgctgctgaacaggtgggctctatggttcttcaagaatgaccgcagc
cgagcctggtaggacaacctgcatctggtcaccaagtttgacaccgtggaggacttttgg
gcgatgtacagtcacatccagctggccagtaagctctcttctggctgtgactacgccctg
ttcaaggatggcattgagcccatgtgggaagatagcaggaataagaggggtggccgctgg
ctggtcagtcttgccaagcagcagcgtcacagtgagctggaccgcctgtggctggagacc
ctgctctgtctgatcggggagagctttgaggaacacagccgggaggtgtgtggggctgtc
atcaacatccgaaccaagggagacaagattgctgtgtggaccagggaggcagagaaccag
gcgggtgtgctgcacattgggcgtgtgtacaaagagcgcctgggcctctccacgaagatc
gtcattgggtaccaggcccatgcagacactgccaccaagagcaactccctagccaagaat
aagtttgtggtgtga

DBGET integrated database retrieval system