KEGG   Felis catus (domestic cat): 101088344Help
Entry
101088344         CDS       T02385                                 

Gene name
EP300
Definition
E1A binding protein p300
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
cAMP signaling pathway
HIF-1 signaling pathway
FoxO signaling pathway
Cell cycle
Wnt signaling pathway
Notch signaling pathway
TGF-beta signaling pathway
Adherens junction
Jak-STAT signaling pathway
Long-term potentiation
Melanogenesis
Thyroid hormone signaling pathway
Huntington's disease
Tuberculosis
Hepatitis B
Influenza A
HTLV-I infection
Herpes simplex infection
Epstein-Barr virus infection
Pathways in cancer
Viral carcinogenesis
MicroRNAs in cancer
Renal cell carcinoma
Prostate cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    101088344 (EP300)
   04330 Notch signaling pathway
    101088344 (EP300)
   04350 TGF-beta signaling pathway
    101088344 (EP300)
   04630 Jak-STAT signaling pathway
    101088344 (EP300)
   04066 HIF-1 signaling pathway
    101088344 (EP300)
   04068 FoxO signaling pathway
    101088344 (EP300)
   04024 cAMP signaling pathway
    101088344 (EP300)
 Cellular Processes
  Cell growth and death
   04110 Cell cycle
    101088344 (EP300)
  Cellular commiunity
   04520 Adherens junction
    101088344 (EP300)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101088344 (EP300)
   04916 Melanogenesis
    101088344 (EP300)
  Nervous system
   04720 Long-term potentiation
    101088344 (EP300)
 Human Diseases
  Cancers
   05200 Pathways in cancer
    101088344 (EP300)
   05206 MicroRNAs in cancer
    101088344 (EP300)
   05203 Viral carcinogenesis
    101088344 (EP300)
   05211 Renal cell carcinoma
    101088344 (EP300)
   05215 Prostate cancer
    101088344 (EP300)
  Neurodegenerative diseases
   05016 Huntington's disease
    101088344 (EP300)
  Infectious diseases
   05152 Tuberculosis
    101088344 (EP300)
   05166 HTLV-I infection
    101088344 (EP300)
   05164 Influenza A
    101088344 (EP300)
   05161 Hepatitis B
    101088344 (EP300)
   05168 Herpes simplex infection
    101088344 (EP300)
   05169 Epstein-Barr virus infection
    101088344 (EP300)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101088344 (EP300)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Other transcription factors
   Pocket domain CBP
    101088344 (EP300)
Mitochondrial biogenesis [BR:fca03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Coactivators
    101088344 (EP300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 2424 aa AA seqDB search
MAENVVEPGPPSAKRPKLSSPALSASASDGTDFGSLFDLEHDLPDELINSTELGLTNGGD
ISQLQTSLGIVQDAASKHKQLSELLRSGSSPNLNMGVGGPGQGMASQAQQNSPGLGLINS
MVKSPMAQAGLTSPNMGMGTSGPNQGPTPSAAGMMNSPVNQPTMGMNTGMNAGMNPGMLN
AGNGQGMIPNQVMNGSIGAGRGRPNMQYPNPGMGNAGNLMTEPLQQGSPQMGGQTGLRGP
QPLKMGMMNNPNPYGSPYTQNSGQQIGASGLGLQIQTKSVLPNSLPPFAMDKKAVPGGGM
PNMGQQQAPQVQQPGLVTPVAQGMGSGAHTADPEKRKLIQQQLVLLLHAHKCQRREQANG
EVRQCNLPHCRTMKNVLNHMTHCQSGKSCQVAHCASSRQIISHWKNCTRHDCPVCLPLKN
AGDKRNQQSILTGAPVGLGNTSSLGVGQQSTPSLSTVSQIDPSSIERAYAALGLPYQVNQ
MPTQPQVQAKNQQTQQSGQSPQGMRPMSNMSASPMGVNGGVGVQTSNLLSDSMLHSAINS
QNPMMSENASVASLGPMPTAAQPSNTGIRKQWHEDITQDLRNHLVHKLVQAIFPTPDPAA
LKDRRMENLVAYARKVEGDMYESANNRAEYYHLLAEKIYKIQKELEEKRRTRLQKQNMLP
SAAGMVPVSMNPGPNMGQPQPGMTSNGPLPDPSMIRGSVPNQMMPRITPQPGMNQFGQMS
MPQPPIGPRQTSPLQHHGQLAQPGTLNPPMGYGPRMQQPSSQSQFLPQTQFSTQGMNVTN
MPLAPSGGQAPVSQAQMSSSSCPVNSPIMPPGSQGSHIHCPPLPQSALHQNSPSPVPSRT
PTPHHTPPSIGAQQPPATAIPAPVPTPPAMPPGPQTQALHPPPRQTPTPPPTQLPPQVQP
SLPAAPSADQPQQQPLSQQSTAASVPTPTAPLLPPQPATPLSQPAVSIEGQVSNPPSTSS
TEVTSQTIPEKQPSQEVKMEAKMEVDQPEPADTQPEDIPETKAEDCKMEPTETEERGTEL
KTETKEEEDQPSTSATQSSPAPGQSKKKIFKPEELRQALMPTLEALYRQDPESLPFRQPV
DPQLLGIPDYFDIVKSPMDLSTIKRKLDTGQYQEPWQYVDDIWLMFNNAWLYNRKTSRVY
KYCSKLSEVFEQEIDPVMQSLGYCCGRKLEFSPQTLCCYGKQLCTIPRDATYYSYQNRYH
FCEKCFNEIQGESVSLGDDPSQPQTTINKEQFSKRKNDTLDPELFVECTECGRKMHQICV
LHHEIIWPSGFVCDGCLKKSARTRKENKFSAKRLPSTRLGTFLENRVNDFLRRQNHPESG
EVTVRVVHASDKTVEVKPGMKARFVDSGEMAESFPYRTKALFAFEEIDGVDLCFFGMHVQ
EYGSDCPPPNQRRVYISYLDSVHFFRPKCLRTAVYHEILIGYLEYVKKLGYTTGHIWACP
PSEGDDYIFHCHPPDQKIPKPKRLQEWYKKMLDKAVSERIVHDYKDIFKQATEDRLTSAK
ELPYFEGDFWPNVLEESIKELEQEEEERKREENTSNESTDVTKGDSKNAKKKNNKKTSKN
KSSLSRGNKKKPGMPNVSNDLSQKLYATMEKHKEVFFVIRLIAGPAANSLPPIVDPDPLI
PCDLMDGRDAFLTLARDKHLEFSSLRRAQWSTMCMLVELHTQSQDRFVYTCNECKHHVET
RWHCTVCEDYDLCITCYNTKNHDHKMEKLGLGLDDESNSQQAAATQSPGDSRRLSIQRCI
QSLVHACQCRNANCSLPSCQKMKRVVQHTKGCKRKTNGGCPICKQLIALCCYHAKHCQEN
KCPVPFCLNIKQKLRQQQLQHRLQQAQMLRRRMASMQRTGVVGQQQGLPSPTPATPTTPT
GQQPTTPQTPQPQPPSQPQPTPPNSMPPYLPRTQAPGPVSQGKAAGQVTPPTPPQTAQPP
LPGPPPAAVEMAMQIQRAAETQRQMAHVQIFQRPIQHQMPQMTPMAPMGMNPPPMARGPS
GHLEPGMGPTGMQQQPPWAQGGLPQPQQLQPGMPRPAMMSVAQHGQPLNMAPQPGLGQVG
VSPLKPGTVSQQALQNLLRTLRSPSSPLQQQQVLSILHANPQLLAAFIKQRAAKYANSNQ
QPLPGQPGMPQGQPGLQPPTMPGQQGVHSNPAMPNMNPMQAGVQRAGLPQQQPPQQQLQP
PMGGMSPQAQQMNMNHNAMPSQFRDLLRRQQMMQQQQQQQGAGPGIGPGMANHNQFQQPQ
GVGYPPPQQQQQQQQRMQHHMQQMQQGNMGPMGQLPQALGAEAGASLQAYQQRLLQQQMG
SPAQPNPMSPQQHMLPNQAQSPHLQGQQIPSSLSNQVRSPQPVPSPRPQSQPPHSSPSPR
MQPQPSPHHVSPQTSSPHPGLVAAQANPMEQGHFASPDQSSMLSQLASNPGMANLHGASA
TDLGLSTDNSDLNSNLSQSTLDIH
NT seq 7275 nt NT seq  +upstreamnt  +downstreamnt
atggccgagaatgtggtggaaccggggccgccttcagccaagcggcctaaactctcatct
ccggccctctcggcgtcggccagcgatggcacagattttggctctctctttgacttggag
catgacttaccagatgaattaatcaactctacagaattgggactaaccaatggtggtgat
attagtcagcttcagacaagtcttggcatagttcaagatgcagcctctaaacataaacaa
ctgtcagaattgctacggtctggcagttcccctaacctcaatatgggggttggtggccca
ggccaaggcatggccagccaggcccaacagaacagtcctggattaggtttgataaatagc
atggtcaaaagcccaatggcacaggcaggcttgacttctcccaacatgggaatgggcact
agtggaccaaatcagggtcctacgccatctgcagcaggtatgatgaacagtccagtaaat
caacctaccatgggaatgaacacagggatgaatgctggcatgaatcctggaatgctgaat
gcaggcaatggacaggggatgatacccaatcaagtcatgaacggttcaattggagcaggc
cgagggcgacctaatatgcagtacccaaacccaggcatgggaaatgctggcaatttaatg
actgagccactacagcaaggctctcctcagatgggaggacaaacaggattgaggggcccc
cagcctctgaagatgggaatgatgaacaaccctaatccttacggttcaccatacactcag
aattctggacagcagattggagccagtggccttggtctccagattcagacaaagtctgta
ctaccaaatagcttacctccatttgcaatggacaaaaaggcagttcctggtggaggaatg
cccaacatgggtcaacagcaggccccacaggtccagcagccaggcctcgtgactccggta
gcccaagggatgggttctggagcgcacacggctgatccagagaagcgcaagctcatccag
cagcagctcgtgctcctgttgcacgcccacaagtgccagcgccgcgagcaggctaatggg
gaagtaaggcagtgcaaccttccccactgtcgcacgatgaagaacgtcctgaaccacatg
acacactgccagtcaggcaagtcctgccaagtggcacactgtgcatcttctcgacaaatc
atttcacactggaagaattgtacgaggcatgattgtcctgtgtgtctcccccttaaaaat
gctggagataagagaaatcaacagtcaattctgactggagcaccagttggacttggaaat
actagctctctaggggtgggtcagcagtctacccccagcctaagcactgtcagtcagatt
gatcccagctctatagaaagggcctatgcagctcttgggctgccctatcaagtaaatcag
atgccgacgcaaccccaggtgcaagcaaagaaccagcagactcagcagtctggccagtct
ccccaaggcatgcggcccatgagcaacatgagtgctagtcctatgggagtaaatggaggt
gtaggggttcaaacatcgaatcttctttctgactcaatgttgcattcagccataaattct
caaaacccaatgatgagtgaaaatgccagtgtggcctccctaggtcctatgccaacagca
gctcaaccatctaatactggaattcggaaacagtggcatgaagatattactcaggatctt
cgaaatcatcttgttcacaaactagttcaagccatatttcctactccggatcctgctgct
ttaaaagacagacggatggaaaacttggttgcatatgcccggaaagtggaaggagacatg
tacgaatctgcaaataatcgggccgaatactaccacctgctagctgagaaaatctataag
atccagaaagaactagaagaaaaacgaaggactagactacagaaacaaaacatgctacca
agtgctgcaggcatggtaccagtttctatgaatccagggcctaatatggggcagccacaa
ccaggaatgacttctaatggccctctgcctgacccatctatgatccgtggcagtgtgcca
aaccagatgatgcctcggataactccacagcctggtatgaatcaatttggccagatgagt
atgccccagcccccaattggaccccggcaaacctctcctcttcagcaccatggacagtta
gctcagcctggaactctcaacccaccaatgggctatgggcctcgcatgcagcagccttcc
agccagagccagttccttccccagactcagttctcaacacagggaatgaatgtaacgaat
atgcctttggctccgtctggcggtcaggcaccggtgtctcaagcacagatgtccagttct
tcctgccctgtgaattctcctataatgcctccagggtctcaggggagccacattcactgt
ccccctctccctcaatcagctctgcatcagaattcaccctctccagtacctagtcgcacc
cccacgcctcaccacactcccccaagcataggggctcagcagccaccagcaacagcaatt
ccagccccggttcctacacctccagccatgccgcctgggccacagacccaagctctccat
ccacctccaaggcagacacctacaccgccaccaacgcaactccctccccaagttcaacct
tcacttcctgctgccccttccgccgaccagccgcagcagcagcctctctcacagcagagt
acagcagcatctgttcccaccccaacggcaccgctgctgcctccgcagcctgcgactcca
ctttcccagccagctgtaagcattgaagggcaggtatcaaaccctccatctactagcagc
acagaagtgacttctcagaccattcctgagaagcagccttcacaggaagtgaaaatggag
gccaagatggaagtggatcagccagaaccagcagatactcagccggaggacatcccagag
actaaagcagaagactgtaaaatggaacctacagaaacggaggagagaggcacggagtta
aaaactgaaacaaaagaagaggaagaccagccgagtacttcggctacccagtcatctcca
gccccgggacagtcaaagaagaagatttttaaaccagaagagttacgacaggcactgatg
ccaacattggaggcactttaccgacaggatccagaatcccttccctttcgtcaacctgtg
gaccctcaacttctaggaatccctgattactttgatattgtgaaaagccccatggatctt
tccaccatcaagaggaagttagacactggacagtatcaggagccctggcagtatgtggat
gacatttggcttatgttcaacaatgcctggttgtataatcggaaaacatcacgggtgtac
aaatactgctccaagttgtctgaggtctttgaacaagaaattgacccagtaatgcaaagc
cttggatattgttgtggcagaaagttggagttctctccacagacactgtgttgctatggc
aaacagttatgcacaatccctcgtgatgccacttactacagttaccagaacaggtatcat
ttctgtgagaagtgtttcaatgaaatccaaggggagagcgtttctttgggggatgaccct
tcccagcctcaaactacaataaataaagaacaattttccaagagaaaaaatgacacactg
gatcctgaactgtttgttgaatgtacagagtgtggaagaaagatgcatcagatctgtgtc
cttcatcatgaaatcatttggccatctggatttgtctgcgatggctgtttaaagaaatct
gcacgaaccaggaaagagaataaattttctgctaaaaggttgccatctaccaggcttggc
acctttctggagaatcgtgtgaatgactttcttaggcgacaaaatcaccctgagtcagga
gaggtcactgttcgggtagttcatgcttctgacaaaactgtggaagtcaaaccaggcatg
aaagcaaggtttgtagatagtggagagatggcagaatcctttccataccgaaccaaagcc
ctctttgcctttgaagagatagacggtgttgacttatgtttctttggcatgcacgttcaa
gagtatggctctgactgccctccgcccaaccagaggagagtttacatatcatacctcgac
agtgttcatttcttccgtcctaaatgcttgaggaccgcagtgtatcatgaaattctaatt
ggatatttagaatacgtcaagaaattaggatatacaacagggcatatttgggcatgtccc
ccgagcgagggagatgactatatcttccattgccatcctcctgaccagaagataccgaag
cccaagcgactgcaggagtggtataaaaagatgcttgacaaggccgtgtctgagcgaatc
gtccatgactacaaggatatttttaaacaagctactgaagatcgattaacaagtgcaaag
gagttgccttactttgagggtgatttctggcccaatgttctggaagagagcattaaagaa
ctggaacaggaggaggaagagagaaagagagaagaaaacaccagcaatgaaagcacagat
gtgacaaagggagacagcaaaaatgctaaaaagaaaaataataagaaaaccagcaaaaac
aagagcagcctcagtaggggcaacaagaagaagccaggcatgcccaatgtgtccaacgac
ctctcgcagaagctgtatgccacaatggaaaaacacaaagaggtcttctttgtgatccgt
ctcatcgccggccctgccgccaactccctgcctcccattgttgaccctgaccccctcatc
ccctgcgatctgatggatgggcgggatgccttccttaccctcgccagggacaagcacctg
gagttctcttcactgcgcagagcccagtggtccaccatgtgtatgctggtggagctgcac
acccagagccaggaccgctttgtctacacgtgcaacgagtgcaagcaccacgtggagacg
cgctggcactgcaccgtgtgcgaggattacgatttgtgtatcacctgctataacactaaa
aaccatgaccacaaaatggagaaactaggtctcggcctagatgacgagagcaacagccag
caggccgcggccacccagagcccaggagactctcgccgcctgagcatccagcgctgcatc
cagtccctggtgcacgcctgccagtgccgcaacgccaactgctcgctgccgtcctgccag
aagatgaagcgggtcgtgcagcacaccaagggctgcaagcggaaaaccaacggaggctgc
cccatctgcaagcagctcatcgccctgtgctgctaccacgccaagcactgccaggagaac
aagtgcccggtgcccttctgcctcaacatcaagcaaaagctccggcagcagcagctgcag
caccggctgcagcaggcccagatgctccgcaggaggatggccagcatgcagcggaccggc
gtggtggggcagcaacaaggcctgccctccccgactcccgccacgcccaccacgcccacc
ggccagcagcccaccaccccgcagacgccccagccccagcccccctctcagccccagcct
acccctcccaacagcatgccaccctacttgcctaggactcaggctcctggccctgtctcc
cagggtaaggcggcgggccaggtgacccctccgaccccccctcagactgctcagccaccc
cttccggggcccccacctgcggcagtggaaatggcaatgcagattcagagggcggctgag
acgcagcgccagatggcccacgtgcaaatttttcagaggccaatccagcaccagatgccc
cagatgactccgatggcccccatgggtatgaacccaccccccatggccagaggtcccagt
gggcatttggagccagggatggggcccacgggcatgcagcaacagccgccgtgggcccaa
ggaggcttgcctcaaccccagcaactacagcccgggatgccgaggccggccatgatgtca
gtggcccagcacggtcagcccttgaatatggctccccaaccgggactgggccaggtaggc
gtgagccctctcaaaccaggcactgtgtctcaacaagccttacaaaaccttttgcggact
ctcaggtctcccagctctcccctacagcagcaacaggtgcttagtatccttcacgccaac
ccccagctgttggccgcgttcatcaagcagcgggctgccaagtatgccaactctaaccaa
cagcccctccccgggcagcctggcatgccccagggccagccggggctgcagccacctacc
atgccgggccagcagggcgtccactctaatccggccatgccgaacatgaaccccatgcag
gcaggcgtccagagggccggcctgccgcagcagcagccaccgcagcagcagctccagcca
cccatgggagggatgagcccccaggctcagcagatgaacatgaatcacaacgccatgcct
tcacagttccgagacctcttgagacggcagcagatgatgcagcagcagcagcagcagcag
ggagccgggcccggaatcggccctggaatggccaaccacaaccagttccagcaaccccag
ggagttggctaccccccaccgcagcagcagcagcagcagcagcagcggatgcagcatcac
atgcaacagatgcaacaagggaacatgggaccgatgggccagctcccccaggccttggga
gccgaggcaggagccagtctgcaggcgtatcagcagcgactcctccagcaacagatgggg
tcccccgctcagcccaaccccatgagcccccaacagcatatgctcccaaaccaggctcag
tccccacacctccaaggccagcagatcccttcttctctctccaatcaagtgcgttcaccc
cagcctgtcccttctccgcggccacagtcccagcccccccactccagcccttccccgagg
atgcagcctcagccttctccacaccacgtgtccccacagaccagttctccacatcctgga
ctggtagctgcccaggccaaccccatggaacaagggcattttgccagcccggaccagagt
tcaatgctttctcagctcgctagcaatccaggcatggcaaacctccatggtgcaagcgcc
acggacctgggactcagcaccgataactcagacttgaattcaaacctctcacagagtaca
ctagacatacactag

DBGET integrated database retrieval system