KEGG   Felis catus (domestic cat): 101088360Help
Entry
101088360         CDS       T02385                                 

Gene name
CHRM4
Definition
cholinergic receptor, muscarinic 4
Orthology
K04132  
muscarinic acetylcholine receptor M4
Organism
fca  Felis catus (domestic cat)
Pathway
Neuroactive ligand-receptor interaction
Cholinergic synapse
Regulation of actin cytoskeleton
Class
Environmental Information Processing; Signaling molecules and interaction; Neuroactive ligand-receptor interaction [PATH:fca04080]
Cellular Processes; Cell motility; Regulation of actin cytoskeleton [PATH:fca04810]
Organismal Systems; Nervous system; Cholinergic synapse [PATH:fca04725]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D1
AA seq 478 aa AA seqDB search
MANFTPVNGSSGNQSVRLVTSTHNRYETVEMIFIATVTGSLSLVTVVGNILVMLSIKVNR
QLQTVNNYFLFSLACADLIIGAFSMNLYTVYIIKGYWPLGAVVCDLWLALDYVVSNASVM
NLLIISFDRYFCVTKPLTYPARRTTKMAGLMIAAAWVLSFVLWAPAILFWQFVVGKRTVP
DNQCFIQFLSNPAVTFGTAIAAFYLPVVIMTVLYIHISLASRSRVHKHRPEGPKEKKAKT
LAFLKSPLMKQSIKKPPPGEAAQEEVRNGKLEEAPPPVLPPPPRPMADKDTSNESSSGSA
TQNTKERPPTELSTTEATAPAMPAPPLQPRALNPASKWSKIQIVTKQTGNECVTAIEIVP
ATPAGMRPAANVARKFASIARNQVRKKRQMAARERKVTRTIFAILLAFILTWTPYNVMVL
VNTFCQSCIPDTVWSIGYWLCYVNSTINPACYALCNATFKKTFRHLLLCQYRNIGTAR
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atggcgaacttcacaccagtcaacggcagctcgggcaaccagtctgtgcgcttggtcaca
tcgacccataaccgctacgagacggtggagatgatattcatcgccacggtgacaggctcg
ttgagcctggtgactgtcgtgggcaacatcctggtgatgctgtctatcaaggtcaacagg
cagctgcagacggtcaacaactacttcctcttcagcctcgcgtgtgccgatctcatcata
ggcgctttctccatgaacctctacaccgtgtacatcatcaagggctactggcctctgggc
gccgtggtctgtgacttatggctggccctggactacgtggtgagcaacgcctctgtcatg
aaccttctcattatcagctttgaccggtacttctgcgtcaccaagcccctcacctacccg
gcccggcgcaccaccaagatggcgggcctcatgatcgccgctgcctgggtcctgtccttc
gtgctctgggcacctgccatcttgttctggcagtttgtggtgggcaagcggaccgtgcca
gacaaccagtgcttcatccagttcctgtccaacccagcagtgaccttcggcacagccatc
gctgccttctacctgcccgtggtcatcatgacggtgctctacattcacatctccctggcc
agtcgcagccgggttcacaagcaccggcccgagggccctaaggagaagaaggccaagact
ctggccttcctcaagagccccctgatgaagcagagcatcaagaaacccccaccgggggaa
gccgctcaagaggaggtgcgcaacggcaagctagaggaggcgcccccaccggttctgcca
ccgccgccgcgcccgatggccgacaaggacacttccaatgagtccagctccggcagtgcc
acgcagaacaccaaggaacgaccacccacagagctgtccaccacagaggccaccgcgcct
gccatgcccgcccctcccctacagccgcgggccctcaacccggcctccaaatggtccaag
atccagattgtgacaaagcagacgggcaacgaatgcgtgacagccatcgagatcgttccc
gccacaccagctggcatgcgtccggcggccaacgtggcccgcaagttcgccagcattgcc
cgcaaccaggtgcgcaagaagcggcagatggcggcccgggagcgcaaggtgacacggacc
atctttgccatcctgctggccttcattctcacctggacgccctacaacgtcatggtcctg
gtgaacaccttctgccagagctgcattcccgacacggtgtggtccatcggctactggctc
tgctacgtcaacagcaccatcaaccctgcctgctatgccctctgcaatgccacctttaaa
aagaccttcaggcacctgctgctgtgccagtatcggaacatcggcactgccaggtag

DBGET integrated database retrieval system