KEGG   Felis catus (domestic cat): 101088483Help
Entry
101088483         CDS       T02385                                 

Gene name
CLOCK
Definition
clock circadian regulator
Orthology
K02223  
circadian locomoter output cycles kaput protein [EC:2.3.1.48]
Organism
fca  Felis catus (domestic cat)
Pathway
Circadian rhythm
Dopaminergic synapse
Herpes simplex infection
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Nervous system
   04728 Dopaminergic synapse
    101088483 (CLOCK)
  Environmental adaptation
   04710 Circadian rhythm
    101088483 (CLOCK)
 Human Diseases
  Infectious diseases
   05168 Herpes simplex infection
    101088483 (CLOCK)
Enzymes [BR:fca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.48  histone acetyltransferase
     101088483 (CLOCK)
Transcription factors [BR:fca03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   Factors with PAS domain
    101088483 (CLOCK)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
B1
AA seq 844 aa AA seqDB search
MLFTVSCSKMSSIVDREDGSIFDGLVEEDDKDKAKRVSRNKSEKKRRDQFNVLIKELGSM
LPGNARKMDKSTVLQKSIDFLRKHKEITAQSDASEIRQDWKPTFLSNEEFTQLMLEALDG
FFLAIMTDGSIIYVSESITSLLEHLPSDLVDQSIFNFIPEGEHSEVYKILSTHLLESDSL
TPEYLKSKNQLEFCCHMLRGTIDPKEPSTYEYVKFIGNFKSLNSVSTSAHNGFEGTIQRT
HRPSYDDRVCFVATVRLATPQFIKEMCTVEEPNEEFTSRHSLEWKFLFLDHRAPPIIGYL
PFEVLGTSGYDYYHVDDLENLAKCHEHLMQYGKGKSCYYRFLTKGQQWIWLQTHYYITYH
QWNSRPEFIVCTHTVVSYAEVRAERRRELGIEESLPETAADKSQDSGSDNRINTVSLKEA
LERFDHSPTPSASSRSSRKSSHTAVSDPSSTPTKIPTDTSTPPRPHLPAHEKMAPRRSSF
SSQSINSQSVGQSLTQPVMSQAANLPIPQGMSQFQFSAQLGAMQHLKDQLEQRTRMIEAN
IHRQQEELRKIQEQLQMVHGQGLQMFLQQSTPGLNFGSVQLSSGNSSNIQQLAPISMQGQ
VVQTNQIQSGMNTGHIGTTQHMIQQQTLQSTSSQQSQQNVLSGHSQQTSLPSQTQSTLTT
PLYNTMVISQPAAGSMVQIPSSMPQNSTQSTAVTTFTQDRQIRFSQGQQLVTKLVTAPVA
CGAVMVPSTMLMGQVVTAYPTFATQQQQPQALPATQQQNSQEQPLASVQQPSQAPLTQPP
QQFLQTSRLLHGNPSTQLILSAAFPLQQSTFPQSHHQQHQSQQQQQLNRHRTDSLTDPSK
VQPQ
NT seq 2535 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaccgtaagctgtagtaaaatgagctcgattgtcgacagagaagatggtagt
atatttgatgggttggtggaagaagatgacaaggacaaagcaaaaagagtatctagaaac
aaatctgaaaagaaacgtagagatcaatttaatgttctcattaaagaactgggatccatg
cttcctggtaatgctaggaagatggacaaatctactgttctgcagaagagcattgatttt
ttacgaaaacataaagaaatcactgcacagtcagatgccagtgaaattcgacaggactgg
aaacctacattccttagtaatgaagaatttacacaattaatgttagaggctcttgatggt
ttttttttagcaatcatgacagatggaagcataatatatgtgtctgagagtataacttca
ttacttgaacatttaccatctgatcttgtggatcaaagtatatttaattttatcccagaa
ggggaacattcagaggtttataaaatactctctactcatctgctggaaagtgattcatta
acccctgaatatttaaaatcaaaaaatcagttagaattctgttgtcatatgcttcgagga
acaatagacccaaaggagccatctacctatgaatatgtgaaatttataggaaatttcaaa
tctttaaacagtgtatcgacttcagcacacaatggttttgaaggaactatacaacgcaca
cacaggccttcttatgatgatagagtttgttttgtagccactgtcagattagctacacct
cagttcatcaaggaaatgtgcactgttgaagaacctaatgaagagtttacatccagacat
agtttagaatggaagttcctatttctagatcacagggcaccacctataataggatatttg
ccatttgaagttctgggaacatcaggctatgattactatcatgtggatgacctagaaaac
ttggcaaaatgccatgagcacttaatgcagtacgggaaaggcaaatcatgttattataga
ttcctcaccaagggacaacagtggatttggcttcagactcattattatatcacttatcat
cagtggaattctaggccagaatttattgtttgtactcacaccgtagtaagttatgcagaa
gttagggctgaaagacgacgagaacttggcattgaagagtctcttcctgagacagctgct
gacaaaagccaagattctgggtctgataatcgtataaacacagtcagtctcaaagaagcc
ttggaaaggtttgatcacagcccaactccttctgcttcctcccggagttcaagaaaatca
tctcacacagcagtctcagacccttcctcaacaccaacaaagatcccaacagatactagc
actcctcccagaccgcatttaccagctcatgaaaagatggcaccaaggaggtcatcattt
agtagtcagtccataaattcccagtctgttggtcagtcattaacacaaccagtgatgtct
caagctgcaaatttaccaattccacaaggcatgtcccagtttcagttttcagctcagtta
ggagccatgcagcatctaaaagaccaattagagcaacggacacggatgatagaggcaaac
attcatcggcaacaagaagaactaagaaaaattcaagaacaacttcaaatggtccatggt
caagggctgcagatgtttttacagcagtcaacccctggtttgaattttggttctgttcaa
ctttcttctggaaattcatctaacatccagcaacttgcacctataagtatgcagggccag
gtcgttcaaaccaaccaaattcagagtggaatgaatactggacacattggcacaactcag
catatgatacaacagcagactttacaaagtacatcaagtcagcagagtcaacaaaatgta
ctgagtgggcacagtcaacaaacctcgcttcctagtcagacacagagcacactcaccact
ccgctgtataacactatggtgatctcacagccggcagccggaagcatggtccagattcca
tctagcatgccacagaacagtacccagagcactgctgtaactacattcactcaggacaga
cagatcagattttctcaaggtcagcagcttgtgaccaaattagtaactgctcctgtagct
tgtggggcggtcatggtacccagcacaatgctcatggggcaggtggtgactgcctaccct
acgtttgctacccagcagcagcagccacaggcactgccagccacacagcagcagaactcc
caggaacagccgcttgcttcagttcagcaaccttctcaggctccgctgacccaaccacca
cagcagtttttacagacttcaaggttgctccacgggaatccttcgactcagcttatcctc
tctgctgcatttccactacaacagagcactttccctcagtcacatcaccagcagcaccag
tctcagcaacagcagcaactgaatcggcacaggactgacagtttgaccgatccttccaag
gttcaaccacagtag

DBGET integrated database retrieval system