KEGG   Felis catus (domestic cat): 101088560Help
Entry
101088560         CDS       T02385                                 

Gene name
SETMAR
Definition
SET domain without mariner transposase fusion
Orthology
K11433  
histone-lysine N-methyltransferase SETMAR [EC:2.1.1.43]
Organism
fca  Felis catus (domestic cat)
Pathway
Lysine degradation
Class
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fca00310]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
A2
AA seq 291 aa AA seqDB search
MARLWDQSAQLFWCSFKRDPEQTNTFLLLQYTPDHVAGPGTDIDPTQITFPGCICLKTCL
PGTCSCLRHAENYDDNSCLIDTGSQGKCANPVFECNILCQCSDQCKNRVVQQGLQFQLQV
FKTDKKGWGLRTLEFIPKGRFVCEYAGEVLGYSEVQRRIQLQTIQNPNYIIAVREHVYSG
QVIETFVDPASIGNIGRFLNHSCEPNLLMIPVRIDSMVPKLALFAAKDILPEEELSYDYS
GRFLNLMDSKDKERLDQGKTRKPCYCGTRSCAAFLPYDSSLYCPLGKSNIS
NT seq 876 nt NT seq  +upstreamnt  +downstreamnt
atggcccggctgtgggaccagagtgcacagctcttttggtgctcttttaaacgggatcct
gaacagaccaatacatttctgcttttgcagtatactcctgaccacgtagctggacctgga
acagacatcgatcccacacaaataacctttccgggatgcatttgtctcaaaacctgcctc
cctggtacttgctcctgtctccgtcatgcagagaactatgatgataattcctgccttata
gatacaggatcccaaggcaagtgtgccaacccggtttttgaatgcaatatcctgtgccag
tgcagtgaccagtgcaagaacagagtggtccagcaaggtctacagttccaactccaggtg
ttcaagacggataaaaaaggctggggacttcgtaccttggaatttataccaaaaggacgg
tttgtctgtgagtatgccggagaagttttgggatactctgaagtacagagaagaattcag
ttacaaacaatacagaacccaaattacattatagccgtcagagaacatgtttacagtggg
caggtaatagaaacatttgttgatcctgcctctataggaaatattggaagatttcttaac
cattcttgtgagccaaacctgttgatgattcctgtccgaattgactcaatggtacccaag
ttggcactttttgcagccaaagacattttgccagaagaagaactctcttatgactattcg
ggaagatttcttaatttaatggacagcaaagacaaagaaaggctagatcaagggaaaaca
agaaaaccttgttattgcggcaccaggtcgtgtgctgctttcctcccttatgacagttca
ctatactgccccttaggaaagtcaaacataagttag

DBGET integrated database retrieval system