KEGG   Felis catus (domestic cat): 101088592Help
Entry
101088592         CDS       T02385                                 

Gene name
ALDH1L2
Definition
(RefSeq) aldehyde dehydrogenase 1 family member L2
  KO
K00289  
formyltetrahydrofolate dehydrogenase [EC:1.5.1.6]
Organism
fca  Felis catus (domestic cat)
Pathway
One carbon pool by folate
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    101088592 (ALDH1L2)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.6  formyltetrahydrofolate dehydrogenase
     101088592 (ALDH1L2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 912 aa AA seqDB search
TPNTQAHFKNKLKLALIGQSLFGQEVYSHLRKEGHRVVGVFTVPDKDGKTDPLALAAEKD
GTPVFKFPRWRVKGKTIKEVAEAYKSVGAELNVLPFCTQFIPMDVIDSPKYGSIIYHPSI
LPRHRGASAINWTLIMGDKKAGFSVFWADDGLDTGPILLQKSCDVEPNDTVDALYNRFLF
PEGIKAMVEAVQLIADGKAPRIPQPEEGATYEGIQKKENAEISWDQSAEVLHNWIRGHDK
VPGAWTEINGQMVTFYGSSLLKSSVPSGEPLEIKGATKPGLVTKNGLVLFGNDGKALMVR
NLQFEDGRMIPASQYFSAGETSVLELTAEEVKVAGTIKVIWAGILSNVPVIEDSTDFFKS
GASSMDVVRLVEEIRQKCGGLQLQNEDVYLATKFEDFIQKVVRKLRGEESEEELVVDYVS
KEVNEMTVKMPYQCFINGQFTDADDGKTYDTINPTDGSIICKVSYASLVDVDKAVAAAKD
AFENGEWGRMNARERGRLMYRLADLLEENQEELATIEALDSGAVYTLALKTHIGMSVQTF
RYFAGWCDKIQGSTIPINQARPNRNLTFTKKEPLGVCAIIIPWNYPLMMLAWKSAACLAA
GNTLVLKPAQVTPLTALKFAELSVKAGFPKGVINIIPGSGGIAGQRLSEHPDIRKLGFTG
STAIGKQIMKSCAVSNLKKVSLELGGKSPLIIFNDCELDKAVRMGMGAVFFNKGENCIAA
GRLFVEEAIHDEFVTRVVEEIKKMKIGDPLDRSTDHGPQNHKAHLEKLLQYCEAGVKEGA
TLVYGGRQVQRPGFFMEPTVFTDVEDHMYLAKEESFGPIMVISKFQNGDIDGVLQRANNT
EYGLASGVFTRDINKAMYVSEKLEAGTVFVNTYNKTDVAAPFGGVKQSGFGKDLGEEALN
EYLKTKTVTLEY
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
actccaaatacccaggcccatttcaaaaacaagctgaagctggcacttattggtcagagc
cttttcggacaggaagtgtacagtcacctccgcaaagagggccaccgagttgtgggcgtg
ttcacggttccagacaaggatggcaaaactgacccgctggctttagctgcagagaaagat
gggacccccgtgttcaagttccccagatggagagtcaagggcaagaccataaaggaggtg
gcagaggcctacaaatctgtgggtgctgagctaaacgtgcttcccttctgcacacagttt
atccccatggatgtaattgacagcccaaagtacggctccatcatatatcacccctccatc
cttcccaggcatagaggagcctctgctatcaactggactctaattatgggagataagaaa
gctgggttttctgttttctgggctgatgatggtttagacacaggacccatccttcttcag
aagtcatgtgatgttgaacccaatgatacagtggatgcactttataatcggtttctcttt
cctgaaggaatcaaagccatggtggaagctgttcaactcatagccgatggaaaagctcct
cgcattccccaaccagaagaaggagcaacatatgaaggcatccagaaaaaggaaaatgct
gagatttcttgggatcagtctgccgaagttttgcataactggatccgaggtcatgataaa
gtccctggagcttggacagagataaatggacagatggtcacgttttatggctcgtcattg
ctgaaaagctccgtgccttctggagaaccactggaaatcaaaggtgccacgaagcctggt
cttgttaccaaaaatggacttgttctttttggtaatgatggaaaagcactgatggtgagg
aatttgcagtttgaagatggaagaatgattccagcctctcagtacttttcagcgggtgag
acctcagtgctagaacttacagccgaagaggtgaaggtggcagggaccatcaaggtcatc
tgggctggaattttaagtaacgtccctgttattgaagactcgacagacttctttaaatct
ggagcaagctcaatggatgttgtcaggctggttgaagagatcagacagaagtgcggtggg
cttcaactacagaatgaagatgtctatctggccaccaagtttgaagacttcattcagaaa
gttgtgaggaaactgagaggagaagaatcggaagaggagctggtggtggattatgtttca
aaggaggtcaatgaaatgacagtgaaaatgccatatcagtgtttcataaatggacagttc
acagatgctgatgatggaaagacctatgatactatcaacccaacagacggatctataata
tgcaaagtatcctatgcttctttggtggatgttgataaagcagtagcagcagcaaaagat
gcctttgaaaacggtgaatggggaagaatgaatgcaagagaaagaggaaggttgatgtac
agacttgcagacctactggaagagaaccaggaggagctggcaaccattgaagcccttgat
tcaggggctgtctacaccctggctctgaagactcacatcggaatgtctgtgcaaacattc
agatattttgctggctggtgtgacaaaattcagggttctactattccaatcaaccaggcc
cgtccaaatcgcaatctgaccttcaccaagaaggagccgcttggggtctgcgccattatc
atcccctggaattacccactgatgatgctggcgtggaaaagcgccgcgtgtctggccgcg
ggtaacaccctagtgctcaagccagcgcaggtcacgcccttgactgctttgaagtttgct
gagctctccgtgaaagcaggctttcccaagggggtaatcaacatcatcccaggctcaggt
ggcatagctgggcaacgcctttctgaacatcctgatatccgtaaacttggtttcactggg
tccactgctattggcaaacagatcatgaagagctgtgctgtgagcaacctgaagaaagtt
tcccttgaacttggtggcaaatccccacttataatattcaatgactgtgaacttgacaag
gccgtgagaatgggcatgggggcagtatttttcaacaaaggagagaactgtattgcagcc
gggcgcttgtttgtggaagaagccatccacgatgaatttgtgacaagagtggtggaagaa
attaaaaagatgaaaattggtgatccacttgacagatctaccgatcacgggccccaaaat
cataaggcccatctggaaaagcttctgcaatactgtgaagctggagtgaaagagggggcc
accttggtgtacgggggaagacaagttcaaaggccaggcttttttatggaaccaactgtg
ttcacagatgtggaagaccacatgtatcttgccaaagaggaatcatttgggcccataatg
gtcatttctaagttccaaaatggggacatcgatggagtgttgcagcgagcaaataacaca
gagtacggtttggcctcaggggtttttacaagagacataaataaagccatgtacgtgagc
gagaaactagaagcgggaactgtttttgttaacacctacaacaagacggacgtggccgcc
cctttcggtggggttaaacaatctggctttgggaaagacttaggtgaggaagctctaaac
gaatacctcaaaaccaagactgtgacgctggaatactag

DBGET integrated database retrieval system