KEGG   Felis catus (domestic cat): 101088629Help
Entry
101088629         CDS       T02385                                 

Gene name
POMT1
Definition
protein-O-mannosyltransferase 1
Orthology
K00728  
dolichyl-phosphate-mannose-protein mannosyltransferase [EC:2.4.1.109]
Organism
fca  Felis catus (domestic cat)
Pathway
Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    101088629 (POMT1)
Enzymes [BR:fca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.109  dolichyl-phosphate-mannose-protein mannosyltransferase
     101088629 (POMT1)
Glycosyltransferases [BR:fca01003]
 O-Glycan biosynthesis
  O-linked Man type (Man a1- Ser/Thr)
   101088629 (POMT1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D4
AA seq 728 aa AA seqDB search
MLGFLKHPVVVTADINLNVVALTAMGLLSRLWQLSYPRAVVFDEVYYGQYISFYMKRIFF
LDGSGPPFGHMLLALGGYLGGFDGNFLWNRIGAEYSSNVPVWSLRLLPALTGALSVPMAY
QILSELGFSHCAAMGAALLMLIENALITQSRLMLLESVLIFFNLLAVLSYLKFSNSQKQR
PFSPSWWFWLTLTGVACSCAVGVKYVGVFTYLLVLAVAGVHAWHLIGDRSLSNVSVLCHL
LARAAALLVVPAAMYLLFFYVHLSLVYRSGPHDQIMSSAFQASLEGGLARITQGQPLEVA
YGSQVTLKNVFGKPVPCWLHSHQSTYPMIYENGRGSSHQQQVTCYPFKDVNNWWIVKDPG
RHQLVVSNPPRPVRHGDVVQLVHGMTTRFLNTHDVAAPLSPHSQEVSCYVDYNVSMPSQN
LWRLDIVNRDSDAGVWKTILSEVRLVHVNTSAVLKLSGAHLPDWGFRQLEVVGEKLSRGY
HESTVWNVEEHRYGKSEEVRSRNGMPPXPGQVPARXGVWLSARLKPVALLQWRMLTAKSD
GSEHKYSSSPLDWVTLDTSIAYWLHPRTSAQIHLLGNVVIWASASLATAVYTLLFFWYLL
RRRRKICDLPEDSWLRWVLAGALCAGGWAVNYVPFFLMEKTLFLYHYLPALTFQILLLPV
VLQHISDHLCRTQLLRSLFSALLVAWYSCACHVFNTLRPLTYGDKSLSPSELKALRWKDS
WDILIRKY
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atgttgggatttttgaagcaccccgtcgtggtgacggctgacatcaacttgaacgttgtg
gctctgactgcaatggggttactgagccgcctgtggcagctctcctatccaagggctgtg
gttttcgatgaagtgtattatgggcagtacatctctttttacatgaagcggatcttcttt
ttggatggcagtggaccaccatttggccacatgctgctggcactgggaggttatttagga
ggattcgatggtaacttcttgtggaacagaatcggagcagaatacagcagcaacgtgccc
gtgtggtctctgcgcctgctgcccgccctcacgggggccctgtcggtccccatggcctac
cagatcctgtcggagcttggtttttctcactgtgccgccatgggggccgccctgctgatg
ctcatcgagaacgctctcatcactcagtcaaggctaatgcttttggagtccgtgttaata
ttctttaatctgttggctgtgctgtcctacctgaagttctccaactcccaaaaacagagg
cccttctctccgagctggtggttttggctgacgctgaccggagtggcctgctcctgtgcc
gtgggcgtcaagtacgtgggtgttttcacgtacctgctcgtgctcgctgtcgctggcgtc
cacgcctggcacctgataggagaccggagtctgtcaaacgtctctgtgctctgtcacctg
ctggcccgcgcggcagctctgttggtcgtcccggccgccatgtacttgctgttcttttac
gtccacctgagtctggtctaccgctctgggccccacgatcaaatcatgtccagtgccttc
caggccagcttggagggagggctggctcggatcacgcagggccagcccctggaggtggcc
tacggttcccaggtcactctgaagaacgtttttggcaaacccgtgccctgctggcttcat
tcccaccagagcacctaccccatgatatacgagaacggccgaggcagctcgcaccagcag
caggtgacctgttaccccttcaaagacgtcaacaactggtggatcgtaaaggaccctggg
aggcaccagctggtggtgagcaaccctccgaggcccgtgcggcatggagacgtggtgcag
ctggtgcacggcatgaccacgcgcttcctcaacacgcacgacgtcgcggcgcccctgagc
ccccactcgcaggaggtatcctgctacgtcgactacaacgtctccatgccttctcagaac
ctctggagactggacatcgtaaacagagactccgacgcgggggtttggaagaccatcttg
tccgaggtccgcctggtgcacgtgaacacctccgcggtcctgaagctcagcggggcacac
ctcccggactgggggttccggcagctggaggtcgtcggggagaagctgtcgcggggctac
cacgagagcaccgtgtggaacgtggaggagcaccgctacggcaaaagtgaagaggtcaga
agcagaaacgggatgcccccgtgaccgggacaggtccctgcgcggtgaggcgtctggctg
tccgcccgcctcaagcctgtggccttgttgcagtggagaatgctgacggccaagagcgac
ggctcggagcacaagtacagctcgtcgccactggactgggtcacgctggacaccagcatc
gcttactggctgcatcccaggaccagcgctcagatccacctgcttgggaacgtcgtgatc
tgggcttcggccagcctcgccactgcggtctacactctgctcttcttctggtacctgctt
agacgccgaagaaagatctgtgacctccctgaggattcctggctgcgctgggtgctggcg
ggggctctgtgtgccggcggctgggcggtgaactacgtccccttcttcctgatggagaag
acgctcttcctgtaccactacctgccggcgctcaccttccagatccttctgctccccgtg
gtcttgcagcacatcagcgaccacctgtgcaggacccagctcctgaggagcctcttcagc
gccctgctcgtggcgtggtactcctgtgcctgtcacgtgttcaacacgctgcgcccgctc
acctacggggacaagtcactctcccccagcgaactgaaggcccttcgctggaaggacagc
tgggacattttgattcgcaaatactag

  All links  
No link information was found.   
DBGET integrated database retrieval system