KEGG   Felis catus (domestic cat): 101088679Help
Entry
101088679         CDS       T02385                                 

Gene name
USP33
Definition
ubiquitin specific peptidase 33
Orthology
K11848  
ubiquitin carboxyl-terminal hydrolase 20/33 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
C1
AA seq 1042 aa AA seqDB search
MSPEKSKDNRLSQEAFDGRANTEGCSGSGLYLQFCKKNYPMGQMNATEGLGLRTWSLRPR
PRPGGGAGYLCSSAPSRPTAAPQTPAASAETPEGAAAAAGSGRCGRRPPLAVLAGPAGKA
VEVLPHLEILGRQEKVTNKMSPFQNHCPHLDSVGEITKEDLMQKSHGTCQDCKVRGPNLW
ACLENRCSYVGCGESQVDHSTIHSQETKHYLTVNLTTLRVWCYACSKEVFLDRKLGTQPS
LPHVRPPHQTQENSVQDFKIPSSTTLKTPLVAVFDDLDIEVEEEDELKARGLTGLKNIGN
TCYMNAALQALSNCPPLTQFFLDCGGLARTDKKPAICKSYLKLMTELWHKSRPGSVVPTT
LFQGIKTVNPTFRGYSQQDAQEFLRCLMDLLHEELKEQVMEVEEDPQTITTEETMEEDKS
QSDVDFQSCESCSSSDKAENENGSKVFSEDNNETTMLIQDDENNSEMSKDWQKEKMCNKI
NKVNSEGELDKDRDSVSETVDLNNQETVKVQIHSRASEYITDVHLNDLSTSQILPSNEGV
NPRLSASPPKSGNLWPGLAPTHKKGRSFSYSEEKQHKKYRSVISDIFDGTIISSVQCLTC
DRVSVTLETFQDLSLPIPGKEDLAKLHSSSHPTSIVKAGSCGEAYAPQGWIAFFMEYVKS
WFWGPVVTLQDCLAAFFARDELKGDNMYSCEKCKKLRNGVKFCKVQKFPEILCIHLKRFR
HELMFSTKISTHVSFPLEGLDLQPFLAKDSPVQIVTYDLLSVICHHGTASSGHYIAYCRN
NLNNLWYEFDDQSVTEVSESTVQNAEAYVLFYRKSSEEAQKERRRISNLLNIMEPSLLQF
YISRQWLNKFKTFAEPGPISNNDFLCIHGGVPPRKAGYIEDLVLMLPQNIWDNLYSRYGG
GPAVNHLYICHTCQIEAEKIEKRRKTELEIFIRLNRAFQEEDSPATFYCISMQWFREWES
FVKGKDGDPPGPIDNTKIAVTKCGNVMLRQGADSGQISEETWNFLQSIYGGGPEVILRPP
VVHVDPDSLQAEEKIEVETRSL
NT seq 3129 nt NT seq  +upstreamnt  +downstreamnt
atgtcacctgaaaagtctaaagacaatagactatcccaagaggcctttgatggcagagca
aatacagagggctgcagtggcagtggcctgtacttgcaattctgcaagaaaaattatcct
atgggccaaatgaatgccacagaaggcctgggtctccgcacctggtccctacggccgcgg
ccacgccctgggggcggggcggggtatctttgcagctccgccccttcccgcccaaccgcg
gcgccccagacgcctgcggcgtccgcggagacaccggaaggagctgcggctgctgcggga
agtggccggtgcggccgcaggccaccattggccgtgctggcggggcccgcggggaaggcc
gtggaggtgttacctcatttggaaatacttgggagacaggaaaaagttactaacaaaatg
tcaccttttcaaaatcattgtccacatttggattcagttggtgaaataacgaaagaagac
ttaatgcaaaaatctcatggtacttgtcaggattgtaaagtcagaggaccaaatctttgg
gcatgtttggagaatagatgttcatatgttggttgtggtgaatcacaagtagatcacagc
actatacattctcaggagacaaagcattatcttactgtgaaccttactactcttcgagta
tggtgttatgcttgcagcaaagaagtatttttggataggaaattaggaactcagccttct
ttgcctcatgtaagaccacctcaccaaacccaagaaaatagtgtccaggattttaaaata
ccaagtagtacaacattaaaaactcctctggttgctgtatttgatgatttggacatagaa
gtggaagaagaagatgaacttaaggcaagaggtcttacaggtttgaaaaatattggaaat
acttgttatatgaatgcagctttgcaggctctttctaattgcccacctttgacacagttt
tttcttgattgtggaggactagctcgaacagataagaaaccagccatttgtaaaagttat
ctgaaactgatgaccgaactgtggcataaaagcaggccaggatccgttgttcccactact
ctgtttcaaggaattaagacagtaaatccaacatttcgggggtattctcagcaggatgct
caagaattccttcggtgtttaatggatttgcttcatgaagaattaaaagaacaggtcatg
gaggttgaggaggatcctcaaactataacgactgaggagaccatggaagaggacaagagc
cagtcagatgtagattttcagtcctgtgaatcttgtagcagcagtgataaagcagaaaat
gaaaatggctctaaagtcttttctgaagataataatgaaacaacaatgttaattcaggat
gatgagaacaattcagaaatgtcaaaagattggcaaaaagagaagatgtgcaataagatt
aataaagtaaattctgaaggagagttagataaagacagagactctgtgtctgaaacagtc
gacttgaacaaccaggaaactgtcaaagtgcaaatacacagcagagcttcagaatatatt
actgatgtccatttgaatgacctgtctacatcacagatcctcccatcaaatgaaggtgtt
aatccacgtttatcagcaagccctcctaaatcaggcaatttgtggccaggattggcaccc
acacacaaaaaaggtagaagtttcagttattcagaggaaaaacagcataagaaataccga
agtgttatttcagacatatttgacggaacaattattagttcagtgcagtgtctgacttgt
gacagggtgtctgtaaccctcgagacctttcaagatctgtccttgccaattcctggcaag
gaagaccttgctaagctgcattcatccagtcacccaacttctatagtcaaagcaggatca
tgtggcgaagcatatgctccacaagggtggatagcttttttcatggaatatgtgaagagc
tggttttggggtccagtagtaaccttgcaagattgtcttgctgccttctttgccagagat
gaactaaaaggtgacaatatgtacagttgtgaaaaatgcaaaaaattaaggaatggagta
aagttttgtaaagtacaaaaatttcctgagattttatgcatccatcttaaaagattcaga
catgaactgatgttttccaccaaaatcagtacccatgtttcatttccactggaaggtctg
gatcttcagccatttcttgcaaaagatagtccagttcagattgttacctatgatcttctg
tcagtcatttgtcatcatggaactgcaagtagtggacactatattgcttactgccgaaac
aatttaaataatctctggtatgaatttgatgatcagagtgtcactgaagtttcagaatct
actgtacaaaatgcagaagcttatgttcttttctataggaagagcagtgaagaggcacaa
aaagagagacgaaggatatcaaatttattgaacataatggaaccaagtctccttcagttt
tacatttctcgacagtggctaaataaatttaagacttttgctgaacctggccctatttca
aataatgattttctctgtattcacggaggcgttcctccacgaaaagctggttatattgaa
gacctggttttgatgctgcctcagaacatttgggataacctgtatagcaggtatggagga
ggaccagctgtcaaccatctgtacatttgtcacacttgtcaaattgaggcagagaaaatt
gaaaaaagaagaaaaactgaactggaaatttttattcggctaaacagagcattccaagag
gaggactctccagctactttttattgcatcagtatgcagtggtttagagaatgggaaagt
tttgtgaagggtaaagatggagatcctccaggtcctattgataacactaaaattgcagtc
actaaatgtggcaatgtaatgctcaggcaaggagcagattctggtcagatttcagaagaa
acatggaattttctacagtctatatatggtggagggcccgaagttatcctacgacctcca
gttgttcatgttgaccctgatagtctgcaagcagaagaaaaaattgaagtagaaactcgg
tccttgtaa

DBGET integrated database retrieval system