KEGG   Felis catus (domestic cat): 101088695Help
Entry
101088695         CDS       T02385                                 

Gene name
PLCE1
Definition
(RefSeq) 1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase epsilon-1 isoform X1
  KO
K05860  phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
fca00562  Inositol phosphate metabolism
fca01100  Metabolic pathways
fca04014  Ras signaling pathway
fca04015  Rap1 signaling pathway
fca04020  Calcium signaling pathway
fca04024  cAMP signaling pathway
fca04070  Phosphatidylinositol signaling system
fca04919  Thyroid hormone signaling pathway
fca04933  AGE-RAGE signaling pathway in diabetic complications
fca05205  Proteoglycans in cancer
Module
fca_M00130  Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101088695 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101088695 (PLCE1)
   04015 Rap1 signaling pathway
    101088695 (PLCE1)
   04020 Calcium signaling pathway
    101088695 (PLCE1)
   04070 Phosphatidylinositol signaling system
    101088695 (PLCE1)
   04024 cAMP signaling pathway
    101088695 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101088695 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101088695 (PLCE1)
  Endocrine and metabolic diseases
   04933 AGE-RAGE signaling pathway in diabetic complications
    101088695 (PLCE1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101088695 (PLCE1)
Membrane trafficking [BR:fca04131]
 Exocytosis
  Calcium ion-dependent exocytosis
   Phospholipases
    101088695 (PLCE1)
 Endocytosis
  Macropinocytosis
   Phospholipase C
    101088695 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PI-PLC-X PI-PLC-Y RA RasGEF C2 EF-hand_like
Motif
Other DBs
NCBI-GeneID: 101088695
NCBI-ProteinID: XP_019669119
Ensembl: ENSFCAG00000006259
UniProt: A0A2I2UZT6
Position
D2
AA seq 2315 aa AA seqDB search
MTSEEMAASVLTPVTQRKVTSSPSALDESSEKVSDVSVLKAHSVRQSGQTSTISRLNKLK
EESSGSNLPKIVSIAREKIMSDENSNEKYWEESMPDSVKNLNINCNNVLKNSQCSLPQSQ
CYDTCDSVMEEGLCLETGIPSSLERRVFPGIQLEVDGPPMDISPLGNQSAIIESGRAHPD
GSMAAFHFHYEVDRRMSDTFCTLSDNLILDDCGNCVPLPGVHGERQKNYMAYTCKLMEMA
ENCDNKNGQLQCDHCDALNDRYLCFEASCQRPDAVCSSDSFCREDFTNSPPAKTFLSHFE
DFPDSCEDVEEDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGHIGLGAY
SYIDQKRSGLLLPCGRVLERRSAVAVREDGSWCLSEAQWYSIYNAVRRREEIENTIGSLL
HFFTKLPASETAHERIRVGPCLKQCVRDTICEYRATLQRTSISQYIAGSLLEATTSLGAR
SGLLSTFGGSTGRMMLKERQPGTSMANSSALPSSSAGISKELIDLQPLIQFPEEVASILM
EQEQNIYRRVLPVDYLCFLTRDLGSPECQTSLPCLKASISASILNSQNGEHNALEDLVMR
FNEVSSWVTWLILTAGSMEEKREVFSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMW
QFMDQSDLETMRSLKDAMAQHESSCEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGA
SGLMKLCPRYNSQEETLEFVADYSGQDHFLQRVGHNGLKNSEKESTVNSIFQIIRSCSRS
LEAEEEDSPSEGNSSRKNSLRDKARWQFIIGDLLDSENDIFEKSKEWDAHGSEEPQKAFD
HGTELIPWYVLSIRADVHQFLLQGATVIHYDQDTHLSARCFLQLQPDNSTLTWTKPTTAS
LASAKAKLGVLSNTSEPGKFPLLGNAGLSGLAEGVLDLFSAKAVYMGHPSIDIHTVCVQN
KLGSMFLSETGVTLLYGLQTTDNRLLHFVAPRHTAKMLFSGLLELTRAVRKMRKFPDQRQ
QWLRKQYVSLYQEDGRYEGPTLAHAVELFGGRRWSTRNPSPGTSAKSAEKPNVQRNNTLG
ISTTKKKKKILIRGESGEAADDEMATRKAKMHRECRSRSGSDPQDMNEQEESEANAIMSP
PNTLPSRRAHSLTTAGSPNLSAGTSSPNRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGM
KGFQSFMVSDSNMSFVEFVELFKSFSVRSRKDLKDLFDVYAVPCNRAGSESVPLYTNLTI
DENTSDLQPDLDLLTRNVSDLGLFIKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLG
VFGVGILQLNDFLVNCQGEHCTYDEILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNF
ASKNDESQENIKELQLPLSYYYIESSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDC
WDGDDGLPIIYHGHTLTTKIPFKEVVEAIERSAFVNSDLPIIISIENHCSLPQQRKMAEI
FKSVFGEKLVAKFLFESDFSDDPMLPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLA
SMQAQAYNGGNANPPPANNEEEEDEEDEYDYDYESLSDADVLTASPAPNSQEDNILEDRP
ENKSCNDKLQFEYNEEIPKRIKKADNSACNKGKVYDMELGEEFYLPQNKKESRQIAPELS
DLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSIFGNNPGRMSPGETASFNKASGKSSCE
GMRQAWEESSSPLNPTTSLSAIIRTPKCYHISSLNENAAKRLCRRYSQKLIQHTACQLLR
TYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLHLNAAMFEANGGCGYVLKPPVLW
DKNCPMYQKFSPLERDLDNMEPAIYSLTIVSGQNVCPSSSTGSPCIEVDVLGMPLDSCHF
RTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENNSSAVTAQRIIPLKALKRGYRHL
QLRNLHNEVLEISSLFINSRRMEENSSSSTTPASLMFNSEERKCLQAHRVTVHGVPGPEP
FTVFSISGGTKAKQLLQQILTTEQDTKPIITDYFLMEEKYFISKEKNECRKQPFQRVIGP
EEEIMQILSSWFPEEGYVGRIVLKTQQENLEEKSIVQDDKEVTLSSEEESFFVQVHDVSP
EQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNPSDYVLLEEVVKDTTKKSSTPKS
SQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASREDKRKGISFASEFKKFTKSTKQPR
GLASPSQVLALEGVQNKEEKPMGSLSSSDTMDYRQ
NT seq 6948 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatggcagcttctgttctcacacctgtgactcagagaaaggtgaca
tcgtctccgtcggctttagatgaaagtagtgaaaaggtctcagacgtcagtgttctgaag
gcacatagtgtcaggcagagtggtcagacttccaccatctcgcgactgaacaagcttaaa
gaagaatcctctggaagcaacttgcccaagattgtctccatagcaagggagaagataatg
agtgatgagaacagcaatgagaagtactgggaggaaagcatgccagattctgtgaaaaac
ctcaatattaactgcaacaacgtactgaaaaacagccagtgcagccttcctcagagccag
tgttatgacacgtgcgattctgtcatggaggaaggcctgtgtttggaaactggaatccca
tcctcactggaaagaagggtgttccctggaattcaactggaagtggacggacctcccatg
gacattagtcccttaggaaatcagtcggccatcatagagagcggccgggcacaccctgac
ggcagcatggcagcatttcactttcattatgaagttgacagaagaatgtcagacactttc
tgtaccttgtcagacaacctgattttggatgattgtggtaactgtgtaccactgcctggt
gttcatggggagcgacagaaaaattatatggcatatacttgtaaactcatggaaatggca
gaaaactgtgataataagaatgggcagctgcagtgtgatcattgtgacgccttaaacgac
agatacttgtgcttcgaagcttcttgccaaaggcctgatgcggtgtgttcaagtgacagc
ttttgcagggaggactttactaacagtccacctgccaagacctttctgagccattttgag
gacttccctgatagttgtgaagatgtagaagaagatttttttaagagcaaaaaggagagg
tccactttgttagtgagaagattttgtaaaaatgacagggaagtaaagaaatctgtatat
actgggacaagggcgatcatgagaactctgccttctggtcacattgggctgggagcttac
agttacattgatcagaagagaagtggtctcctgctgccctgtgggagagttctggaacgg
cggtcagcggtggcagttagggaagatgggagctggtgcctgtcagaagctcagtggtat
tcgatctacaatgcagtgagaaggagagaagaaatagaaaatacaattggatctcttctt
catttcttcacaaagctcccagcctccgaaacagcccatgaaaggattagggttggtccg
tgcttaaagcaatgtgtccgagataccatatgtgagtaccgtgccaccctccagaggacg
tccatatctcagtacatcgcgggttctctgctagaagcaaccacatctttaggagcaaga
agtggcctactcagtacctttggaggatccaccggacgaatgatgctaaaagaacgtcag
ccaggcacctccatggccaattctagtgccctcccttcaagttcagctgggatcagcaag
gagctgattgatctgcagcccctcattcagttcccagaggaagtcgccagcatcctgatg
gagcaggagcagaacatttaccgaagggtcttgccagttgactacctttgcttcttgacc
cgggacttgggctctccagaatgccagacatccctgccctgcctcaaagcgtccatctca
gcatcaattcttaactcccagaacggagaacacaatgccctggaagatcttgtgatgaga
tttaatgaggtgagctcctgggtaacgtggctgatcctcacggcgggctccatggaggag
aagcgagaagtcttctcctatttagtgcacgtggccaaatgctgctggaacatgggcaac
tacaatgctgtcatggagttcttggccggcctcaggtcaagaaaagttttaaaaatgtgg
cagtttatggaccagtctgacctagagaccatgaggagcctgaaggatgccatggctcag
cacgaatcttcctgcgagtacaagaaggtggtcacgcgggctctgcacatacctggctgt
aaggtggttccgttctgtggggtgtttctgaaggagctctgtgaagtactggacggagcc
tccggcctcatgaagctttgcccgaggtacaattcccaagaagaaactctagagtttgta
gccgattacagtggacaagatcatttcttacaacgagtgggacataatggcttaaagaat
tcggagaaggagtccacagtcaacagcatctttcagatcatcaggagctgcagccgaagt
ctggaggccgaggaggaggacagccccagtgaaggaaacagctccaggaaaaattcctta
agggataaagcccgatggcagtttatcattggagacctgttagattctgaaaatgacatc
tttgagaaatccaaagaatgggacgctcacggatcagaagagccacagaaggcctttgac
catgggacagagctaatcccatggtacgtgctgtccatccgagccgatgtgcaccagttc
ctgctgcagggggccactgtcatccactatgaccaggacacgcacctctctgcccgatgc
ttcctccagcttcagcctgacaacagcaccttgacctggacaaagcccaccactgcttcc
ctggccagtgctaaagcaaaactcggtgtgcttagtaacacgtctgagcctggcaaattc
ccgttactgggcaatgctggactaagtggcctggcagagggggtcttggatctgttctca
gcaaaagctgtgtacatgggacaccctagcatcgatatacacactgtgtgtgttcagaac
aaactgggtagcatgtttctctcagagactggcgtgacgctgctctatgggctccagacc
acggacaatagattattgcactttgtggcacccaggcacacagctaagatgctcttcagt
ggattgctggaactcacgagagccgtgaggaagatgaggaagttccctgaccagagacag
cagtggctgcggaaacagtacgtcagcctctatcaggaagatggacggtacgaaggccca
actttggctcacgccgtggagttgtttggtggcaggcggtggagtacacgaaaccccagc
cccgggacatcagcaaagagtgccgagaagcccaatgtgcagagaaacaacaccttgggc
ataagcactaccaagaaaaagaagaaaatccttataaggggtgagagcggagaggcagcc
gacgatgagatggccacccgaaaagccaaaatgcacagagagtgtcgcagccggagtggt
tctgaccctcaagacatgaatgaacaagaagaatcagaggcaaatgccatcatgagccct
cctaacactctgccttccagaagagcccactctttgaccacggctgggtcccctaacttg
tctgccgggacatcatctcccaacaggccagtgtcttcccctgtgctgtcttcttcaaac
aagagcccgtccagtgcttggagcagcagcagctggcacgggaggatcaaaggcggaatg
aaaggtttccagagcttcatggtttcagacagtaacatgagctttgttgaattcgttgag
ctgttcaaatcattcagcgtgaggagccgcaaggacctgaaggacctcttcgacgtctac
gccgtgccctgcaaccgagccggctccgagtcggtgccactctacaccaacctaacaatt
gacgaaaacaccagcgatcttcagcctgacctagatttattgaccagaaacgtctcggat
ttggggttgttcattaagagtaaacagcagctgtcagacaaccagaggcagatatctgat
gccattgctgctgcaagtatcgtgacaaacggcactggggtcgagagcacatccttgggc
gtgtttggggttggcatcctccagctcaatgacttcctagtgaactgccaaggagaacac
tgcacttatgatgaaatcctcagcatcatccagaagttcgagcctagcgttagtatgtgt
catcagggcctactgtcatttgaaggatttgcaaggtttctgatggataaagataatttc
gcctccaaaaatgatgagtcacaggaaaacattaaagaactacagctgcccctctcctac
tattacattgaatcttcacacaatacctacctcacaggccaccagctcaaaggagagtcc
tcagtagaactctacagccaggtcctcctgcaaggctgtaggagcgtagagctggattgt
tgggatggagacgacgggttgcccatcatctatcatggacacacgctgacaaccaagatc
cccttcaaggaggtggttgaagccattgaacgcagtgcctttgtcaactctgacctgccc
atcatcatatcgattgagaaccactgctcattgcctcagcaacgaaaaatggcagaaatt
ttcaagagtgtgtttggagaaaaactggtggctaagttcctgtttgagagtgatttctca
gatgacccaatgcttccctcacccgaccaacttaggaggaaagtgctccttaaaaataag
aagctaaaagcccaccaaacaccagtggatatcttaaagcaaaaggctcatcagttagca
tccatgcaagctcaggcttacaatggtgggaatgccaaccccccaccggctaataacgag
gaagaggaggatgaagaagacgaatatgattatgactatgaatccctgtctgatgcagat
gtccttactgcttctcctgctcctaacagtcaggaagacaacattctggaagacagacct
gaaaataaatcatgtaatgacaagcttcagtttgagtataatgaagaaatccccaagagg
ataaagaaagcagataactctgcttgcaacaaaggaaaggtttatgacatggaactggga
gaagaattttatctccctcagaataaaaaggaaagcagacagattgcaccagagctctct
gaccttgtcatctattgtcaagcagtaaaatttccaggcctgtcaactctaaatgcatct
ggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggcaacaatccgggc
agaatgagccctggggagacagcatcgtttaacaaagcatctggaaaaagttcctgtgaa
ggaatgcgacaggcctgggaggaatcttcttcccccctcaacccaaccacatccctcagc
gctatcattagaactcccaaatgttaccatatctcctcgctgaatgaaaatgccgccaaa
cgtctgtgtcgcaggtattctcagaaactgatccagcacaccgcctgtcagctgctgagg
acttacccggctgccactcgcatcgactcctccaaccccaatcccctcatgttctggctc
catgggatacagctcgtggcgctcaactaccagacagatgatctccctttacacttaaat
gctgccatgtttgaagccaacggtgggtgtggttatgttttgaaacccccagttctgtgg
gacaagaactgtcccatgtatcagaagttctctcccttagaaagagatctggacaacatg
gagcctgccatctactccttaactattgtctctggtcaaaacgtgtgcccgagtagcagc
acaggaagcccgtgtatcgaagtcgatgtgctgggcatgcccctggacagctgccatttc
cgcacaaagcccatccaccggaacactctgaaccccatgtggaatgaacagtttctcttc
cgggttcactttgaagatctcgtatttcttcgttttgccgttgtggaaaacaacagctca
gctgtaactgctcagagaatcatcccactcaaggctttaaaacgaggatatcgacatctt
cagctgcgaaatctccacaacgaagtcttggaaatctctagtttattcataaacagtagg
aggatggaagaaaattcctccagcagcaccacgccggcctctttgatgtttaattcagaa
gaaagaaaatgtttgcaggctcacagagtcacggtgcatggggtcccaggtccagagccc
tttactgttttctccataagtggaggcaccaaagcaaagcagcttctccaacaaattctg
accactgaacaagacaccaaacctatcatcacagactattttttgatggaagaaaaatat
tttatatctaaagaaaagaatgaatgcaggaaacaaccgttccagagagtcattggtcca
gaggaagagattatgcagattttaagcagctggtttccagaggaaggatatgttggcagg
attgtcttaaaaacccagcaggaaaacctagaagagaaaagcattgttcaagatgacaaa
gaggtgaccttgagctcagaggaggagagtttctttgttcaagtgcacgatgtttctcca
gagcaacctcgaacggtcatcaaagcaccccgtgtcagcaccgcacaggacgtcattcag
cagaccttatgcaaagcaaagtattcctacagcatcctgagcaatcccaacccaagtgac
tatgtgctcttggaagaggtggtaaaagacacgaccaagaagtcttccaccccaaagtcc
tcccagcgggtccttttggatcaggagtgtgtgtttcaagcccaaagcaagtggaaaggg
gcaggaaaattcatccttaagctaaaggagcaggtgcaggcatctcgagaagacaaaagg
aaaggcatttcttttgcaagtgaatttaagaagttcaccaagtcaactaaacaaccccga
ggactcgcatcaccttctcaggtcttggccttagaaggtgtccaaaacaaggaggagaaa
cctatgggcagcttgtcctccagtgacaccatggactatcgacaataa

DBGET integrated database retrieval system