KEGG   Felis catus (domestic cat): 101088695Help
Entry
101088695         CDS       T02385                                 

Gene name
PLCE1
Definition
phospholipase C, epsilon 1
Orthology
K05860  
phosphatidylinositol phospholipase C, epsilon [EC:3.1.4.11]
Organism
fca  Felis catus (domestic cat)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Ras signaling pathway
Rap1 signaling pathway
Calcium signaling pathway
Phosphatidylinositol signaling system
Thyroid hormone signaling pathway
Proteoglycans in cancer
Module
Inositol phosphate metabolism, PI=> PIP2 => Ins(1,4,5)P3 => Ins(1,3,4,5)P4
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    101088695 (PLCE1)
 Environmental Information Processing
  Signal transduction
   04014 Ras signaling pathway
    101088695 (PLCE1)
   04015 Rap1 signaling pathway
    101088695 (PLCE1)
   04020 Calcium signaling pathway
    101088695 (PLCE1)
   04070 Phosphatidylinositol signaling system
    101088695 (PLCE1)
 Organismal Systems
  Endocrine system
   04919 Thyroid hormone signaling pathway
    101088695 (PLCE1)
 Human Diseases
  Cancers
   05205 Proteoglycans in cancer
    101088695 (PLCE1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.11  phosphoinositide phospholipase C
     101088695 (PLCE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D2
AA seq 2277 aa AA seqDB search
MTSEEMAASVLTPVTQRKVTSSPSALDESSEKVSDVSVLKAHSVRQSGQTSTISRLNKLK
EESSGSNLPKIVSIAREKIMSDENSNEKYWEESMPDSVKNLNINCNNVLKNSQCSLPQSQ
CYDTCDSVMEEGLCLETGIPSSLERRVFPGIQLEVDGPPMDISPLGNQSAIIESGRAHPD
GSMAAFHFHYEVDRRMSDTFCTLSDNLILDDCGNCVPLPSVHGERQKNYMAYTCKLMEMA
ENCDNKNGQLQCDHCDALNDRYLCFEASCQRPDAVCSSDSFCREDFTNSPPAKTFLSHFE
DFPDSCEDVEEDFFKSKKERSTLLVRRFCKNDREVKKSVYTGTRAIMRTLPSGHIGLGAY
SYIDQKRSGLLLPCGRVLERRSVVAVREDGSWCLSEAQWYSLPASETAHERIRVGPCLKQ
CVRDTICEYRATLQRTSISQYIAGSLLEATTSLGARSGLLSTFGGSTGRMMLKERQPGTS
MANSSALPSSSAGISKELIDLQPLIQFPEEVASILMEQEQNIYRRVLPVDYLCFLTRDLG
SPECQTSLPCLKASISASILNSQNGEHNALEDLVMRFNEVSSWVTWLILTAGSMEEKREV
FSYLVHVAKCCWNMGNYNAVMEFLAGLRSRKVLKMWQFMDQSDLETMRSLKDAMAQHESS
CEYKKVVTRALHIPGCKVVPFCGVFLKELCEVLDGASGLMKLCPRYNSQEETLEFVADYS
GQDHFLQRVGHNGLKNSEKESTVNSIFQIIRSCSRSLEAEEEDSPSEGNSSRKNSLRDKA
RWQFIIGDLLDSENDIFEKSKEWDAHGSEEPQKAFDHGTELIPWYVLSIRADVHQFLLQG
ATVIHYDQDTHLSARCFLQLQPDNSTLTWTKPTTASLASAKAKLGVLSNTSEPGKFPLLG
NAGLSGLAEGVLDLFSAKAVYMGHPSIDIHTVCVQNKLGSMFLSETGVTLLYGLQTTDNR
LLHFVAPRHTAKMLFSGLLELTRAVRKMRKFPDQRQQWLRKQYVSLYQEDGRYEGPTLAH
AVELFGGRRWSTRNPSPGTSAKSAEKPNVQRNNTLGISTTKKKKKILIRGESGEAADDEM
ATRKAKMHRECRSRSGSDPQDMNEQEESEANAIMSPPNTLPSRRAHSLTTAGSPNLSAGT
SSPNRPVSSPVLSSSNKSPSSAWSSSSWHGRIKGGMKGFQSFMVSDSNMSFVEFVELFKS
FSVRSRKDLKDLFDVYAVPCNRAGSESVPLYTNLTIDENTSDLQPDLDLLTRNVSDLGLF
IKSKQQLSDNQRQISDAIAAASIVTNGTGVESTSLGVFGVGILQLNDFLVNCQGEHCTYD
EILSIIQKFEPSVSMCHQGLLSFEGFARFLMDKDNFASKNDESQENIKELQLPLSYYYIE
SSHNTYLTGHQLKGESSVELYSQVLLQGCRSVELDCWDGDDGLPIIYHGHTLTTKIPFKE
VVEAIERSAFVNSDLPIIISIENHCSLPQQRKMAEIFKSVFGEKLVAKFLFESDFSDDPM
LPSPDQLRRKVLLKNKKLKAHQTPVDILKQKAHQLASMQAQAYNGGNANPPPANNEEEED
EEDEYDYDYESLSDDNILEDRPENKSCNDKLQFEYNEEIPKRIKKADNSACNKGKVYDME
LGEEFYLPQNKKESRQIAPELSDLVIYCQAVKFPGLSTLNASGSSRGKERKSRKSIFGNN
PGRMSPGETASFNKASGKSSCEGMRQAWEESSSPLNPTTSLSAIIRTPKCYHISSLNENA
AKRLCRRYSQKLIQHTACQLLRTYPAATRIDSSNPNPLMFWLHGIQLVALNYQTDDLPLH
LNAAMFEANGGCGYVLKPPVLWDKNCPMYQKFSPLERDLDNMEPAIYSLTIVSGQNVCPS
SSTGSPCIEVDVLGMPLDSCHFRTKPIHRNTLNPMWNEQFLFRVHFEDLVFLRFAVVENN
SSAVTAQRIIPLKALKRGYRHLQLRNLHNEVLEISSLFINSRRMEENSSSSTTPASLMFN
SEERKCLQAHRVTVHGVPGPEPFTVFSISGGTKAKQLLQQVLTTEQDTKPIITDYFLMEE
KYFISKEKNECRKQPFQRVIGPEEEIMQILSSWFPEEGYVGRIVLKTQQENLEEKSIVQD
DKEVTLSSEEESFFVQVHDVSPEQPRTVIKAPRVSTAQDVIQQTLCKAKYSYSILSNPNP
SDYVLLEEVVKDTTKKSSTPKSSQRVLLDQECVFQAQSKWKGAGKFILKLKEQVQASRED
KRKGISFASEFKKFTKSTKQPRGLASPSQVLALEGVQNKEEKPMGSLSSSDTMDYRQ
NT seq 6834 nt NT seq  +upstreamnt  +downstreamnt
atgacttctgaagaaatggcagcttctgttctcacacctgtgactcagagaaaggtgaca
tcgtctccgtcggctttagatgaaagtagtgaaaaggtctcagacgtcagtgttctgaag
gcacatagtgtcaggcagagtggtcagacttccaccatctcgcgactgaacaagcttaaa
gaagaatcctctggaagcaacttgcccaagattgtctccatagcaagggagaagataatg
agtgatgagaacagcaatgagaagtactgggaggaaagcatgccagattctgtgaaaaac
ctcaatattaactgcaacaacgtactgaaaaacagccagtgcagccttcctcagagccag
tgttatgacacgtgcgattctgtcatggaggaaggcctgtgtttggaaactggaatccca
tcctcactggaaagaagggtgttccctggaattcaactggaagtggacggacctcccatg
gacattagtcccttaggaaatcagtcggccatcatagagagcggccgggcacaccctgac
ggcagcatggcagcatttcactttcattatgaagttgacagaagaatgtcagacactttc
tgtaccttgtcagacaacctgattttggatgattgtggtaactgtgtaccactgcctagt
gttcatggggagcgacagaaaaattatatggcatatacttgtaaactcatggaaatggca
gaaaactgtgataataagaatgggcagctgcagtgtgatcattgtgacgccttaaacgac
agatacttgtgcttcgaagcttcttgccaaaggcctgatgcggtgtgttcaagtgacagc
ttttgcagggaggactttactaacagtccacctgccaagacctttctgagccattttgag
gacttccctgatagttgtgaagatgtagaagaagatttttttaagagcaaaaaggagagg
tccactttgttagtgagaagattttgtaaaaatgacagggaagtaaagaaatctgtatat
actgggacaagggcgatcatgagaactctgccttctggtcacattgggctgggagcttac
agttacattgatcagaagagaagtggtctcctgctgccctgtgggagagttctggaacgg
cggtcagtggtggcagttagggaagatgggagctggtgcctgtcagaagctcagtggtat
tcgctcccagcctccgaaacagcccatgaaaggattagggttggtccgtgcttaaagcaa
tgtgtccgagataccatatgtgagtaccgtgccaccctccagaggacgtccatatctcag
tacatcgcgggttctctgctagaagcaaccacatctttaggagcaagaagtggcctactc
agtacctttggaggatccaccggacgaatgatgctaaaagaacgtcagccaggcacctcc
atggccaattctagtgccctcccttcaagttcagctgggatcagcaaggagctgattgat
ctgcagcccctcattcagttcccagaggaagtcgccagcatcctgatggagcaggagcag
aacatttaccgaagggtcttgccagttgactacctttgcttcttgacccgggacttgggc
tctccagaatgccagacatccctgccctgcctcaaagcgtccatctcagcatcaattctt
aactcccagaacggagaacacaatgccctggaagatcttgtgatgagatttaatgaggtg
agctcctgggtaacgtggctgatcctcacggcgggctccatggaggagaagcgagaagtc
ttctcctatttagtgcacgtggccaaatgctgctggaacatgggcaactacaatgctgtc
atggagttcttggccggcctcaggtcaagaaaagttttaaaaatgtggcagtttatggac
cagtctgacctagagaccatgaggagcctgaaggatgccatggctcagcacgaatcttcc
tgcgagtacaagaaggtggtcacgcgggctctgcacatacctggctgtaaggtggttccg
ttctgtggggtgtttctgaaggagctctgtgaagtactggacggagcctccggcctcatg
aagctttgcccgaggtacaattcccaagaagaaactctagagtttgtagccgattacagt
ggacaagatcatttcttacaacgagtgggacataatggcttaaagaattcggagaaggag
tccacagtcaacagcatctttcagatcatcaggagctgcagccgaagtctggaggccgag
gaggaggacagccccagtgaaggaaacagctccaggaaaaattccttaagggataaagcc
cgatggcagtttatcattggagacctgttagattctgaaaatgacatctttgagaaatcc
aaagaatgggacgctcacggatcagaagagccacagaaggcctttgaccatgggacagag
ctaatcccatggtacgtgctgtccatccgagccgatgtgcaccagttcctgctgcagggg
gccactgtcatccactatgaccaggacacgcacctctctgcccgatgcttcctccagctt
cagcctgacaacagcaccttgacctggacaaagcccaccactgcttccctggccagtgct
aaagcaaaactcggtgtgcttagtaacacgtctgagcctggcaaattcccgttactgggc
aatgctggactaagtggcctggcagagggggtcttggatctgttctcagcaaaagctgtg
tacatgggacaccctagcatcgatatacacactgtgtgtgttcagaacaaactgggtagc
atgtttctctcagagactggcgtgacgctgctctatgggctccagaccacggacaataga
ttattgcactttgtggcacccaggcacacagctaagatgctcttcagtggattgctggaa
ctcacgagagccgtgaggaagatgaggaagttccctgaccagagacagcagtggctgcgg
aaacagtacgtcagcctctatcaggaagatggacggtacgaaggcccaactttggctcac
gccgtggagttgtttggtggcaggcggtggagtacacgaaaccccagccccgggacatca
gcaaagagtgccgagaagcccaatgtgcagagaaacaacaccttgggcataagcactacc
aagaaaaagaagaaaatccttataaggggtgagagcggagaggcagccgacgatgagatg
gccacccgaaaagccaaaatgcacagagagtgtcgcagccggagtggttctgaccctcaa
gacatgaatgaacaagaagaatcagaggcaaatgccatcatgagccctcctaacactctg
ccttccagaagagcccactctttgaccacggctgggtcccctaacttgtctgccgggaca
tcatctcccaacaggccagtgtcttcccctgtgctgtcttcttcaaacaagagcccgtcc
agtgcttggagcagcagcagctggcacgggaggatcaaaggcggaatgaaaggtttccag
agcttcatggtttcagacagtaacatgagctttgttgaattcgttgagctgttcaaatca
ttcagcgtgaggagccgcaaggacctgaaggacctcttcgacgtctatgccgtgccctgc
aaccgagccggctccgagtcggtgccactctacaccaacctaacaattgacgaaaacacc
agcgatcttcagcctgacctagatttattgaccagaaacgtctcggatttggggttgttc
attaagagtaaacagcagctgtcagacaaccagaggcagatatctgatgccattgctgct
gcaagtatcgtgacaaacggcactggggtcgagagcacatccttgggcgtgtttggggtt
ggcatcctccagctcaatgacttcctagtgaactgccaaggagaacactgcacttatgat
gaaatcctcagcatcatccagaagttcgagcctagcgttagtatgtgtcatcagggccta
ctgtcatttgaaggatttgcaaggtttctgatggataaagataatttcgcctccaaaaat
gatgagtcacaggaaaacattaaagaactacagctgcccctctcctactattacattgaa
tcttcacacaatacctacctcacaggccaccagctcaaaggagagtcctcagtagaactc
tacagccaggtcctcctgcaaggctgtaggagcgtagagctggattgttgggatggagac
gacgggttgcccatcatctatcatggacacacgctgacaaccaagatccccttcaaggag
gtggttgaagccattgaacgcagtgcctttgtcaactctgacctgcccatcatcatatcg
attgagaaccactgctcattgcctcagcaacgaaaaatggcagaaattttcaagagtgtg
tttggagaaaaactggtggctaagttcctgtttgagagtgatttctcagatgacccaatg
cttccctcacccgaccaacttaggaggaaagtgctccttaaaaataagaagctaaaagcc
caccaaacaccagtggatatcttaaagcaaaaggctcatcagttagcatccatgcaagct
caggcttacaatggtgggaatgccaaccccccaccggctaataacgaggaagaggaggat
gaagaagacgaatatgattatgactatgaatccctgtctgatgacaacattctggaagac
agacctgaaaataaatcatgtaatgacaagcttcagtttgagtataatgaagaaatcccc
aagaggataaagaaagcagataactctgcttgcaacaaaggaaaggtttatgacatggaa
ctgggagaagaattttatctccctcagaataaaaaggaaagcagacagattgcaccagag
ctctctgaccttgtcatctattgtcaagcagtaaaatttccaggcctgtcaactctaaat
gcatctggctctagcagaggaaaagaaaggaaaagcaggaagtccatttttggcaacaat
ccgggcagaatgagccctggggagacagcatcgtttaacaaagcatctggaaaaagttcc
tgtgaaggaatgcgacaggcctgggaggaatcttcttcccccctcaacccaaccacatcc
ctcagcgctatcattagaactcccaaatgttaccatatctcctcgctgaatgaaaatgcc
gccaaacgtctgtgtcgcaggtattctcagaaactgatccagcacaccgcctgtcagctg
ctgaggacttacccggctgccactcgcatcgactcctccaaccccaatcccctcatgttc
tggctccatgggatacagctcgtggcgctcaactaccagacagatgatctccctttacac
ttaaatgctgccatgtttgaagccaacggtgggtgtggttatgttttgaaacccccagtt
ctgtgggacaagaactgtcccatgtatcagaagttctctcccttagaaagagatctggac
aacatggagcctgccatctactccttaactattgtctctggtcaaaacgtgtgcccgagt
agcagcacaggaagcccgtgtatcgaagtcgatgtgctgggcatgcccctggacagctgc
catttccgcacaaagcccatccaccggaacactctgaaccccatgtggaatgaacagttt
ctcttccgggttcactttgaagatctcgtatttcttcgttttgccgttgtggaaaacaac
agctcagctgtaactgctcagagaatcatcccactcaaggctttaaaacgaggatatcga
catcttcagctgcgaaatctccacaacgaagtcttggaaatctctagtttattcataaac
agtaggaggatggaagaaaattcctccagcagcaccacgccggcctctttgatgtttaat
tcagaagaaagaaaatgtttgcaggctcacagagtcacggtgcatggggtcccaggtcca
gagccctttactgttttctccataagtggaggcaccaaagcaaagcagcttctccaacaa
gttctgaccactgaacaagacaccaaacctatcatcacagactattttttgatggaagaa
aaatattttatatctaaagaaaagaatgaatgcaggaaacaaccgttccagagagtcatt
ggtccagaggaagagattatgcagattttaagcagctggtttccagaggaaggatatgtt
ggcaggattgtcttaaaaacccagcaggaaaacctagaagagaaaagcattgttcaagat
gacaaagaggtgaccttgagctcagaggaggagagtttctttgttcaagtgcacgatgtt
tctccagagcaacctcgaacggtcatcaaagcaccacgtgtcagcaccgcacaggacgtc
attcagcagaccttatgcaaagcaaagtattcctacagcatcctgagcaatcccaaccca
agtgactatgtgctcttggaagaggtggtaaaagacacgaccaagaagtcttccacccca
aagtcctcccagcgggtccttttggatcaggagtgtgtgtttcaagcccaaagcaagtgg
aaaggggcaggaaaattcatccttaagctaaaggagcaggtgcaggcatctcgagaagac
aaaaggaaaggcatttcttttgcaagtgaatttaagaagttcaccaagtcaactaaacaa
ccccgaggactcgcatcaccttctcaggtcttggccttagaaggtgtccaaaacaaggag
gagaaacctatgggcagcttgtcctccagtgacaccatggactatcgacaataa

DBGET integrated database retrieval system