KEGG   Felis catus (domestic cat): 101088764Help
Entry
101088764         CDS       T02385                                 

Gene name
EEA1
Definition
early endosome antigen 1
Orthology
K12478  
early endosome antigen 1
Organism
fca  Felis catus (domestic cat)
Pathway
Endocytosis
Phagosome
Tuberculosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    101088764 (EEA1)
   04145 Phagosome
    101088764 (EEA1)
 Human Diseases
  Infectious diseases
   05152 Tuberculosis
    101088764 (EEA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
B4
AA seq 1453 aa AA seqDB search
MAADGSWLHPSLGVALTERSCLIQDYVPFLETACTSLLVDVENTKNPPLALTPGRVGSQG
SDLDSSAAPINTVDVNNESSSEGFICPQCMKSLGSADELFKHYEVVHDAGNDSSHGGEAL
ALKRDDLTLLRQEVQDLQASLKEEKWYSEELKKELEKFQGLQQQESKPDGLVADSSAELQ
SLEQQLEEAQTENFNIKQMKDLFEQKAAQLATEIADIKSKYDEERSLREAAEQKVTYLTE
ELNKETIIIQDLKTELLQRPGIEDVAVLKKELVQVQTLMDNMTLEREKESEKLKDECKKL
QAEYANSEATISQLRSELAKGPQEVAVYVQELQKLKSSLNELTQKNQNLTEKLRKKELEC
TQLEEKHNEECVSKKNIQASLHQKDLDCQQLQSRLSASETSLQRIQAELGEKGEATQKLK
EELSEVEAKYQHLKAEFKQLQQQREEKEQHGLQLQSEINQLHSKLLETERQLGEAHGRLK
EQRQLSSEKLMDKEQQVADLQLKLSRLEEQLKEKVTNSTELQHQLDKTKQQHQEQQALQQ
STTAKLREAQNDLEQVLRQIGDKDQKIQNLEALLQKSKENISLLEKEREDLYAKIQAGEG
ETAVLNQLQEKNHTLQEQVTQLTEKLKNQSESHKQAQENLHDQVQEQKAHLRAAQDRVLS
LETSVNELNSQLNESKEKVSQLDIQIKAKTELLLSAEAAKTAQRADLQNHLDTAQNALQD
KQQELNKITTQLDQVTAKLQDKQEHCSQLESHLKEYKEKHLSLEQKTEELEGQIKKLEAD
TLEVKGNKEQALQDLQLQRQLNTDLELRATELSKQLEMEKEIVSSTKLELQKKSEALENI
KQMLTKQEEEKKILEQEIENLSQDAKMQHKELNNKIQTAAAELQKSKMEKETLMTELSAA
KENLSKVSDSLKNSKSEFEKENQKGKAAILDLEKTCKELKHQLQVQTENALKEQNELKKS
LEKEKQTSHQLNLELSSMQGQVAQAQNTLKQXEKEEQQLQGNINELKQLTEQKKKQIEAL
QGEIKIAVSQKTELENKLQQQSTQAAQELEAEKEKMSVLQITYEKSQENLKQLQSDFYGK
ESELLATRQDLKSVEEKLSLAQEDLISNRNQIGNQNKLIQELKSSTATLEQDLAKKEQQL
KEQCKTLQDIKKEKSLKEKELVNEKSKLAEIEEIKCRQEKEIAKLSEELKSHKQESIKEV
TNLKDAKQLLIQQKLELQGKVDSLKATLDQEKRNQQMLKEQVKKEEDELKKEFTEKEAKL
HSEIKEKEIGMKKHEENEAKLTMQITALNENLGTVKKEWQSSQRRVSELEKQTDDLRGEI
AVLEATVQNNQDERRALLERCLKGEGEIEKLQTKVLELQRKLDNTTAAVQELGRENQSLQ
IKHTQALNRKWAEDNEVQNCMACGKGFSVTVRRHHCRQCGNIFCAECSAKNALTPSSKKP
VRVCDACFNDLQG
NT seq 4362 nt NT seq  +upstreamnt  +downstreamnt
atggctgccgatggctcttggctgcatccttctctgggagttgccctaacagaaagaagc
tgcctgatccaagattatgtccctttcctggagacagcctgtacttcattactggttgat
gtggagaatacaaagaatcctcctcttgccttgactcctgggagagttggctctcaaggt
tctgatttagattcatcagctgctcctataaacacagtggatgtcaataatgaaagctct
tcagagggtttcatatgtccccagtgtatgaaatcccttgggtctgctgatgaacttttc
aaacactatgaggtagttcatgatgctggtaatgattcaagtcatggaggagaggctctt
gctctgaagcgagatgatttaacactacttagacaagaggtccaagaccttcaggcttca
ctaaaggaagaaaaatggtactcagaagaattaaagaaagaattagaaaaatttcaaggg
ctgcagcagcaagagtctaaacctgatggattggtggctgattcatcagcagaactacag
tctttggaacaacaattagaagaagcccaaacagaaaattttaatattaagcaaatgaaa
gacttatttgaacagaaagcagcccaacttgccactgaaattgcagatataaagtcaaaa
tatgatgaagaaaggagtcttcgagaagctgctgaacaaaaagtgacgtatctgacagag
gaattaaacaaagaaacaattataattcaagatctgaagactgaactgcttcagagacct
ggtatagaagatgttgctgtgctaaagaaagaactggtccaagttcaaacactaatggac
aacatgacgttggagcgtgaaaaagaatctgaaaaactcaaagatgagtgtaaaaagtta
caagcagaatatgctaactcagaggccacaataagccagctaaggagtgaacttgccaaa
ggcccccaggaagttgctgtatatgtgcaggaactacaaaaacttaaaagttcacttaat
gaattaacacaaaaaaatcagaacttgactgaaaagcttcgaaagaaagaactggagtgt
actcagttagaggagaaacataacgaagaatgtgtgagtaaaaagaatatacaagcaagc
cttcatcaaaaagacctagattgtcagcagcttcagtcaagattatctgcatctgaaacc
tccctgcagagaatacaggcagaactaggtgaaaagggggaagctacgcagaagctcaag
gaagaattatcagaagtagaggccaagtaccagcatcttaaggctgaatttaaacagcta
caacaacagagagaagagaaagagcagcacgggttacaactccaaagtgaaattaatcaa
ttacatagcaaacttctggagacagagcgccaactaggtgaagctcatggtaggctgaag
gaacagagacagctttcaagtgaaaagttgatggataaagaacaacaagtggctgatcta
caactcaaactttctcgtttagaagaacagttgaaggaaaaagtaacaaattccacagaa
ttgcagcatcaattagataaaacgaagcaacaacatcaagaacaacaagcccttcagcaa
agcactacagcaaaacttcgagaagctcagaatgatttagaacaagtactacgtcaaatt
ggcgataaggaccagaagatccagaaccttgaagccttattacagaagagtaaagaaaat
atttccttactagaaaaagaaagagaagatctttatgcaaaaattcaggctggtgaagga
gagactgctgttctcaaccagttacaagaaaaaaaccataccttacaggaacaagtaact
caactaacagagaagctgaagaatcagtcagaaagccataaacaagcccaggagaatttg
catgaccaagtgcaagagcagaaggcacatcttagagctgcacaagaccgtgtcctttcc
ttagaaactagtgtcaatgaattaaatagtcaattaaatgagagcaaggagaaggtctcc
cagcttgacatacagattaaagccaaaactgaattattgctatcagcagaagcagcaaaa
actgctcaaagagcagatcttcagaatcatttggacacagcccaaaatgcattacaagat
aaacagcaggagttaaataagatcactactcagttggatcaagtcactgcaaagttacag
gataagcaagaacattgcagtcagttggaaagtcatcttaaagaatataaagagaaacac
ctttctttagaacaaaaaactgaagaattagaaggtcaaattaagaaactagaagctgat
actcttgaagttaaaggaaacaaggagcaagctttgcaggatctacaactgcaaagacag
ctgaatacagatttagagcttagagccacagaattgagtaaacaacttgaaatggagaaa
gaaatagtatccagtacaaagttggaactacagaaaaaatctgaagctcttgaaaatatt
aagcaaatgcttaccaagcaagaggaagaaaaaaaaatccttgaacaagaaattgaaaat
ttaagtcaggatgcaaagatgcagcacaaggaattgaataacaaaattcaaacagcagca
gcagaactgcaaaaatcgaagatggagaaagaaactctaatgacagagctttctgcggcc
aaagagaatttatcaaaagtttctgattctttgaagaactccaaaagtgaatttgaaaag
gaaaaccagaaaggaaaagctgctatattagatttggaaaaaacttgcaaagaattaaag
catcagcttcaagtacagacagaaaatgcacttaaggaacagaatgaactgaaaaagtca
cttgaaaaagagaagcaaacttctcatcagttgaacttggaactcagttcaatgcaggga
caagtggcacaggcccagaatacgttaaaacaanaagaaaaagaagaacagcaacttcag
gggaacataaatgagctaaagcaattgactgaacagaagaaaaagcaaattgaagcactc
caaggagaaattaaaattgctgtttcacagaagacagagcttgagaataaattacagcag
cagtcaacacaagcagcccaggaacttgaagcagagaaagagaaaatgtcagtgttacaa
attacctatgaaaaaagtcaggaaaatctaaaacagcttcaatctgatttctatgggaag
gaatctgaacttcttgccacaaggcaagatcttaagtctgtagaagagaagctttctcta
gcacaagaggacttgatttcaaacagaaatcaaattggaaaccaaaataaattaattcag
gaactgaagagttccacggctacgttggagcaggatttagcaaagaaagagcaacagttg
aaggagcagtgtaaaacgctacaagatattaaaaaagaaaagtcactgaaagaaaaagaa
ctagtaaatgaaaagtctaaattggcagagatagaggaaattaagtgtagacaggaaaaa
gaaattgctaaattgagtgaagaactcaagtcccacaagcaagaaagcataaaggaggta
acaaatctcaaggatgccaaacagcttttgattcagcagaaactcgagcttcaagggaaa
gtagattccctgaaggcaacccttgaccaggagaagagaaaccagcaaatgctaaaagag
caggtgaaaaaggaagaagatgaactaaagaaagagtttactgagaaggaggctaaactg
cattccgagataaaagaaaaagaaataggaatgaagaagcatgaagaaaatgaagctaaa
cttaccatgcagattacagcgttaaatgaaaacttgggcaccgtaaagaaggagtggcag
tctagtcaacgtagagtcagcgagctcgagaaacagacggacgacttacggggtgaaatt
gcagtattagaagccacagttcagaataatcaggatgaaaggagagcactactagaaaga
tgtcttaaaggagaaggtgaaatagaaaagcttcaaaccaaagtactagaattgcaaaga
aagctggataatacgaccgcagcggtgcaggagctgggcagagaaaatcaatcccttcaa
atcaaacacacgcaagcgttaaataggaagtgggcggaagacaatgaagtacaaaactgc
atggcctgtgggaaaggcttttcagtaacagtgagacggcatcactgcagacaatgtgga
aatatcttctgtgctgagtgttcggccaaaaatgccttaactccatcttctaagaagcct
gttcgtgtctgtgatgcatgtttcaatgacttgcaaggataa

DBGET integrated database retrieval system