KEGG   Felis catus (domestic cat): 101088815Help
Entry
101088815         CDS       T02385                                 

Gene name
TMSB4X
Definition
uncharacterized LOC101088815
Orthology
K05764  
thymosin, beta 4
Organism
fca  Felis catus (domestic cat)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101088815 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
X
AA seq 104 aa AA seqDB search
MGLLRTRRRVFVRMRGLDGTDSLKSAHIAARGASRPAFGGGHCADRTSLVRAPRSASSAT
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 315 nt NT seq  +upstreamnt  +downstreamnt
atggggttgctgcgaacaagaagacgagtatttgttcggatgcgtggccttgatggaacc
gattcgctaaagagcgcgcatatagcggcgcgcggcgcgtcccgcccggcattcggcggc
ggccactgcgcagatcggacttcgctcgttcgtgcacctcgctccgcttcctctgcaacc
atgtctgacaaacccgatatggctgagattgagaaattcgataagtcgaaattgaagaag
acagaaacgcaagagaaaaatccgctgccttcaaaagaaacgattgagcaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system