KEGG   Felis catus (domestic cat): 101088815Help
Entry
101088815         CDS       T02385                                 

Gene name
TMSB4X
Definition
(RefSeq) thymosin beta 4, X-linked
  KO
K05764  
thymosin, beta 4
Organism
fca  Felis catus (domestic cat)
Pathway
Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:fca00001]
 Cellular Processes
  Cell motility
   04810 Regulation of actin cytoskeleton
    101088815 (TMSB4X)
Cytoskeleton proteins [BR:fca04812]
 Eukaryotic cytoskeleton proteins
  Actin filaments / Microfilaments
   Actin-binding proteins
    Thymosin
     101088815 (TMSB4X)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
X
AA seq 44 aa AA seqDB search
MSDKPDMAEIEKFDKSKLKKTETQEKNPLPSKETIEQEKQAGES
NT seq 135 nt NT seq  +upstreamnt  +downstreamnt
atgtctgacaaacccgatatggctgagattgagaaattcgataagtcgaaattgaagaag
acagaaacgcaagagaaaaatccgctgccttcaaaagaaacgattgagcaggagaagcaa
gcaggcgaatcgtaa

DBGET integrated database retrieval system