KEGG   Felis catus (domestic cat): 101089065Help
Entry
101089065         CDS       T02385                                 

Gene name
PDIA2
Definition
(RefSeq) protein disulfide-isomerase A2 isoform X1
  KO
K09581  protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101089065 (PDIA2)
Chaperones and folding catalysts [BR:fca03110]
 Protein folding catalysts
  Protein disulfide isomerase
   101089065 (PDIA2)
Membrane trafficking [BR:fca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   PDI family proteins
    101089065 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Thioredoxin Thioredoxin_6 Thioredoxin_2 Thioredoxin_7 OST3_OST6 AhpC-TSA Thioredoxin_8 Redoxin HyaE
Motif
Other DBs
NCBI-GeneID: 101089065
NCBI-ProteinID: XP_003999018
Ensembl: ENSFCAG00000015640
UniProt: M3WMZ8
Position
E3
AA seq 523 aa AA seqDB search
MDGQLLLVLLLLGASGPEGQGPGPGEPEEEPPKEEIPEEDGILVLSRRNLGLALREHRTL
LVQFYAPWCGHCKALAPEYSKAAALLAAESAKARLAKVDGPAETELTEEFAVTAYPTLKF
FRDGNRTHPEEYTGPREAEGIAEWLRRRAGPSATRLEDEDGAQALIDGRDVVVIGFFQDL
QDEDVATFLALAQDALDMTFGLTDRPKLFQKFGLTKDTVVLFKKFDEGRADFPVDEELGL
DQGDLSHFLLTHSMRLVTEFNSRTSPKIFSARILNHLLLFVNQTLASHRELLAGFGEAAP
PFRGQVLFVVVDVGADNGHVLQYFGLKAEEAPTLRFINMETTKKYAPAHGGPLTATSVTA
FCHAVLGGEVKPYLLSQELPPDWDQRPVKTLVGKNFEQVAFDETKNVFIKFYAPWCTHCK
EMAAAWEALAEKYKDHEDIIIAELDATANELEAFPVHGFPTLKFFPAGPGRKVIEYKSTR
DLETFSKFLDNGGELPAEEPAEEPAAPFPETPANSTTEPKEEL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggacggccagctcctgcttgtgctgctgctgcttggggcctcgggcccagagggccag
gggccagggcccggggagcccgaggaggagccccccaaggaggaaatccctgaggaggat
gggatcttggtgctgagccggcgcaacctcggcctggccttgcgggagcaccgcactctg
ctggtgcagttctatgccccatggtgtgggcactgcaaggcactggcccccgaatacagc
aaggccgcagccctgctggcggcagagtcagccaaagccaggctggccaaggtggacggg
cctgcagagacagagctgacggaggagtttgctgtgactgcataccccacgctcaagttc
ttccgcgatgggaaccgcacacacccggaggagtacaccggccccagagaggccgagggc
atcgctgaatggctgaggcggcgggcggggcccagtgccacccggctggaggacgaggac
ggtgcccaggcactgatcgacggccgggatgtcgtggtcattggcttcttccaggacctg
caggacgaggacgtggctaccttcctggccctggcccaggatgccctggacatgaccttt
ggcctcactgaccggccaaagctctttcagaagtttggcctcaccaaggacaccgtggtg
ctcttcaagaagtttgacgagggccgggcagacttcccagtggacgaagagctgggcctg
gatcagggcgacctgtcgcacttcctcctcacgcacagcatgcgtctggtcacagaattc
aacagccggacgtcgccgaagatcttttcggccaggatcctcaaccacctgctgctgttt
gtcaaccagacactggcctcccaccgggagctgctagctggcttcggggaggcagctccc
ccattccgggggcaggtgctgttcgtggtcgtggacgtcggtgccgacaatggccacgtg
ctgcagtacttcggcctcaaggctgaggaggcccccaccctgcgcttcatcaacatggag
accaccaagaagtacgcacctgcacacggggggccgctcaccgcaacctccgtcaccgcc
ttctgccacgcggtcctcggcggcgaggtcaagccctacctcctgagccaggagctgccc
cctgactgggatcagcggccggtcaagaccctcgtgggcaagaattttgagcaggtggct
ttcgacgaaaccaagaatgtgtttatcaagttttacgccccttggtgcacccactgcaag
gagatggctgcggcctgggaggccctggccgagaagtacaaggaccacgaggacatcatc
attgcggaactggacgccacagccaacgagctggaggctttccctgtgcacggcttccct
accctcaagttcttccccgcggggccgggtcgcaaggtgattgaatacaaaagcaccagg
gacctggagaccttctccaagttcctggacaacgggggtgagctgcccgcagaggagccc
gcagaggagcccgcagcccccttcccggagaccccggccaattccaccacggagcccaaa
gaggagctgtag

DBGET integrated database retrieval system