KEGG   Felis catus (domestic cat): 101089065Help
Entry
101089065         CDS       T02385                                 

Gene name
PDIA2
Definition
protein disulfide isomerase family A, member 2
Orthology
K09581  
protein disulfide isomerase family A, member 2 [EC:5.3.4.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     101089065 (PDIA2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
E3
AA seq 526 aa AA seqDB search
MDGQLLLVLLLLLLLGASGPEGQGPGPGEPEEEPPKEEIPEEDGILVLSRRNLGLALREH
RTLLVQFYAPWCGHCKALAPEYSKAAALLAAESAKARLAKVDGPAETELTEEFAVTAYPT
LKFFRDGNRTHPEEYTGPREAEGIAEWLRRRAGPSATRLEDEDGAQALIDGRDVVVIGFF
QDLQDEDVATFLALAQDALDMTFGLTDRPKLFQKFGLTKDTVVLFKKFDEGRADFPVDEE
LGLDQGDLSHFLLTHSMRLVTEFNSRTSPKIFSARILNHLLLFVNQTLASHRELLAGFGE
AAPPFRGQVLFVVVDVGADNGHVLQYFGLKAEEAPTLRFINMETTKKYAPAHGGPLTATS
VTAFCHAVLGGEVKPYLLSQELPPDWDQRPVKTLVGKNFEQVAFDETKNVFIKFYAPWCT
HCKEMAAAWEALAEKYKDHEDIIIAELDATANELEAFPVHGFPTLKFFPAGPGRKVIEYK
STRDLETFSKFLDNGGELPAEEPAEEPAAPFPETPANSTTEPKEEL
NT seq 1581 nt NT seq  +upstreamnt  +downstreamnt
atggacggccagctcctgcttgtgctgctgctgctgctgctgcttggggcctcgggccca
gagggccaggggccagggcccggggagcccgaggaggagccccccaaggaggaaatccct
gaggaggatgggatcttggtgctgagccggcgcaacctcggcctggccttgcgggagcac
cgcactctgctggtgcagttctatgccccatggtgtgggcactgcaaggcactggccccc
gaatacagcaaggccgcagccctgctggcggcagagtcagccaaagccaggctggccaag
gtggacgggcctgcagagacagagctgacggaggagtttgctgtgactgcataccccacg
ctcaagttcttccgcgatgggaaccgcacacacccggaggagtacaccggccccagagag
gccgagggcatcgctgaatggctgaggcggcgggcggggcccagtgccacccggctggag
gacgaggacggtgcccaggcactgatcgacggccgggatgtcgtggtcattggcttcttc
caggacctgcaggacgaggacgtggctaccttcctggccctggcccaggatgccctggac
atgacctttggcctcactgaccggccaaagctctttcagaagtttggcctcaccaaggac
accgtggtgctcttcaagaagtttgacgagggccgggcagacttcccagtggacgaagag
ctgggcctggatcagggcgacctgtcgcacttcctcctcacgcacagcatgcgtctggtc
acagaattcaacagccggacgtcgccgaagatcttttcggccaggatcctcaaccacctg
ctgctgtttgtcaaccagacactggcctcccaccgggagctgctagctggcttcggggag
gcagctcccccattccgggggcaggtgctgttcgtggtcgtggacgtcggtgccgacaat
ggccacgtgctgcagtacttcggcctcaaggctgaggaggcccccaccctgcgcttcatc
aacatggagaccaccaagaagtacgcacctgcacacggggggccgctcaccgcaacctcc
gtcaccgccttctgccacgcggtcctcggcggcgaggtcaagccctacctcctgagccag
gagctgccccctgactgggatcagcggccggtcaagaccctcgtgggcaagaattttgag
caggtggctttcgacgaaaccaagaatgtgtttatcaagttttacgccccttggtgcacc
cactgcaaggagatggctgcggcctgggaggccctggccgagaagtacaaggaccacgag
gacatcatcattgcggaactggacgccacagccaacgagctggaggctttccctgtgcac
ggcttccctaccctcaagttcttccccgcggggccgggtcgcaaggtgattgaatacaaa
agcaccagggacctggagaccttctccaagttcctggacaacgggggtgagctgcccgca
gaggagcccgcagaggagcccgcagcccccttcccggagaccccggccaattccaccaca
gagcccaaagaggagctgtag

DBGET integrated database retrieval system