KEGG   Felis catus (domestic cat): 101089143Help
Entry
101089143         CDS       T02385                                 

Gene name
DHCR7
Definition
7-dehydrocholesterol reductase
Orthology
K00213  
7-dehydrocholesterol reductase [EC:1.3.1.21]
Organism
fca  Felis catus (domestic cat)
Pathway
Steroid biosynthesis
Metabolic pathways
Module
Cholesterol biosynthesis, squalene 2,3-epoxide => cholesterol
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00100 Steroid biosynthesis
    101089143 (DHCR7)
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.21  7-dehydrocholesterol reductase
     101089143 (DHCR7)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
D1
AA seq 475 aa AA seqDB search
MAAKSQPDAPQTKSRDSFANGGAATQGQWGRAWEVDWFSLASVLFLLLLAPFIVYYFIMA
CDQYGCSLTAPVVDLATGRACLADIWAKTPPVTKEAAQLYALWVTFQVLLYSALPDFCHK
FLPGYVGGVQEGAVTPAGVINKYEINGLQAWLITHLLWFANSHFLSLFSPTIIFDNWIPL
LWCANILGYTVSTFAMIKGYFFPTNAKDCKFTGNFFYDYMMGIEFNPRIGKWFDFKLFFN
GRPGIVAWTLINLSFAAKQRELYGQVTNAMVLVNVLQAIYVLDFFWNEAWYLKTIDICHD
HFGWYLGWGDCVWLPYLYTLQGLYLVYHPVQLSTPHAAGVLLLGLLGYYIFRMANHQKDL
FRRTDGRCLIWGRKPRVIECSYTSADGRRHHSKLLVSGFWGVARHLNYTGDLMGSLAYCL
ACGGGHLLPYFYIIYMTILLTHRCLRDEHRCASKYGGDWARYTAAVPHRLLPGIF
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atggctgcaaagtcccagcccgacgctccccaaaccaagagtcgggacagctttgccaac
ggtggggctgccactcaggggcagtggggccgtgcctgggaggtggactggttttcgctg
gccagcgtcctctttctgctgcttttggcccctttcatcgtatactacttcatcatggcg
tgtgaccagtacggctgctccctcactgcccccgtggtggacctcgccaccgggcgcgct
tgtctcgcagacatctgggccaagacgccgcccgtgacaaaggaagcggcccagctctac
gccttgtgggtcacgttccaggtgcttttgtactcggcgctgcctgacttctgccataag
ttcctgcccggctacgtgggaggcgttcaagagggcgccgtgacccctgcaggggttatt
aacaagtatgaaatcaacggtctgcaggcgtggctcatcacgcaccttctctggtttgca
aattcgcacttcctgtcgctgttctcccccaccatcatcttcgacaactggataccgctg
ctgtggtgcgccaacatcctcggctacacggtttccaccttcgcaatgatcaagggctac
ttcttccccaccaatgccaaagactgcaaattcacgggcaatttcttttacgactacatg
atgggcattgagtttaacccccgaatcgggaagtggttcgacttcaagctgtttttcaac
ggacgccctgggattgttgcctggaccctcatcaacctgtcctttgcagccaagcagcgg
gagctctacggccaagtgaccaacgccatggtcctggtcaacgtcctgcaggccatctac
gtgctggacttcttctggaacgaagcctggtacctgaaaaccattgacatctgccacgac
cactttgggtggtacttgggctggggggactgcgtctggctgccgtacctctacacgctg
cagggtctgtacctggtctatcacccggtgcagctgtccaccccccacgccgcgggcgtc
ctgctgctggggctgctaggctactacatcttccggatggccaaccatcaaaaggacctg
ttccgccgcacggacggccgctgcctgatctggggcaggaagcccagggtcatcgagtgc
tcctacacgtcggccgacggacgcaggcaccacagcaagctcctggtgtcgggcttctgg
ggcgtggcccgccacctcaactacacgggcgacctgatgggcagtctggcctactgcctg
gcctgcggcgggggccacctgctgccctacttctacatcatctacatgaccatcctgctg
acccaccgctgcctccgggacgagcaccgctgtgccagcaagtacggcggcgactgggcg
cgttacaccgctgccgtgcctcaccgcctgctgcccggaatcttctga

DBGET integrated database retrieval system