KEGG   Felis catus (domestic cat): 101089230Help
Entry
101089230         CDS       T02385                                 

Gene name
CHP2
Definition
calcineurin-like EF-hand protein 2
Orthology
K17611  
calcineurin B homologous protein 2
Organism
fca  Felis catus (domestic cat)
Brite
Protein phosphatases and associated proteins [BR:fca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     101089230 (CHP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
E3
AA seq 148 aa AA seqDB search
MDLQQIGALAVNPLGERIIDSFFPDGNLRLDFPGFVRVLAHFRPIDDEDPGIRDPKEPEP
LNSRMNKLRFAFQLYDLDRDGKISRHEMLQVLRLMVGVQVTEEQLESIADRTVQEADEDG
DGAVSFLEFTKSLEKMDIEQKMSIRILK
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atggatctgcagcagattggggctctggccgtgaaccccttgggagaacgcattatagac
agcttcttccctgatgggaatctgcgtctggatttcccaggctttgtcagagtcctggct
cattttcgccccatcgatgatgaggacccaggaattcgagaccccaaggaacctgaaccc
ctcaacagcagaatgaacaaacttcgcttcgcatttcagctctacgacctggaccgggac
ggaaagatctcccggcacgagatgctacaggtcctccgactgatggttggggtgcaggtg
acagaagagcagttggagagcatcgctgatcgcacggtgcaggaagcggatgaagatgga
gatggggctgtgtccttcctggagttcaccaagtccttggagaagatggacatcgaacag
aaaatgagcatacggatcctgaagtga

DBGET integrated database retrieval system