KEGG   Felis catus (domestic cat): 101089396Help
Entry
101089396         CDS       T02385                                 

Definition
cytochrome P450 2C41-like
Orthology
K07413  
cytochrome P450, family 2, subfamily C [EC:1.14.14.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Steroid hormone biosynthesis
Arachidonic acid metabolism
Linoleic acid metabolism
Retinol metabolism
Metabolic pathways
Serotonergic synapse
Inflammatory mediator regulation of TRP channels
Chemical carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00140 Steroid hormone biosynthesis
    101089396
   00590 Arachidonic acid metabolism
    101089396
   00591 Linoleic acid metabolism
    101089396
  Metabolism of cofactors and vitamins
   00830 Retinol metabolism
    101089396
 Organismal Systems
  Nervous system
   04726 Serotonergic synapse
    101089396
  Sensory system
   04750 Inflammatory mediator regulation of TRP channels
    101089396
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101089396
Enzymes [BR:fca01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     101089396
Cytochrome P450 [BR:fca00199]
 Cytochrome P450, animal type
  CYP2 family
   101089396
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
D2
AA seq 420 aa AA seqDB search
MKPAVVLHGYKAVKEALIDLGEEFSARGSFPLAERISKGHGILFTNGKRWKEMRRFCLTT
LRNLGMGKSDLESRVQEEAYYLMEELRKTNALPCDPTFVLGCATCNMICSIIFQNRFDYT
DQTLLGFLEKFNENMKILSSSWVQICNSFPALIDYLPGSHHKIFKNFTCTHNYILEKIKE
HQESLDINNPRDFIDYFLIKIKQENHSQQLEFTIENLIATASDLFGAGTETTSTTLRYAL
LLLLKHPEVTAKIQEEIGHVIGRHRSPCMQDRSRMPYMNAVLHEIQRYIDLIPVNLPHAV
TRDIKFRNYVIPKGTTVLISLTSVLRDDKEFPNPETFDPAHFLDDSGNFKKSDYFMVFSA
GKRICVGESLARMELFLFLTSILQNFTLKPVVDIKDLDTTPVASGFGHIPPPYKICFVPL
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atgaagcctgctgttgtgctgcatggatataaggcagtgaaggaagccctgattgatcta
ggagaagagttttctgcaagaggaagtttcccattagctgaaagaattagtaaaggacat
ggaatccttttcaccaatggaaagagatggaaggagatgcggcgcttctgcctcacgacc
ctgcggaatttggggatggggaagagtgaccttgagagccgagttcaagaggaagcctac
tacctcatggaagagttgagaaaaaccaatgccttaccctgtgaccccacttttgtcctg
ggctgtgctacctgtaatatgatctgctccattattttccaaaatcgttttgattataca
gatcagactttacttggcttcctggaaaaatttaatgaaaacatgaagattttgagctcc
tcatgggtccagatctgcaatagtttccctgctctcattgattacctcccaggaagtcat
cacaaaatatttaaaaattttacttgtacacacaattatattttagagaaaatcaaagaa
caccaagaatccttggacattaacaatcctcgggatttcattgattacttcttgatcaaa
ataaaacaggaaaaccacagtcagcagttggagttcactattgaaaacttgatagccact
gcaagtgatttgtttggagctgggacagagaccacaagcaccaccctaagatatgctctc
ctgctcctgctgaagcacccggaagtcacagctaaaatccaggaagagattggccatgta
attggcagacaccggagcccctgcatgcaggacaggagccgcatgccctacatgaatgca
gtgttgcatgagatccagagatacattgaccttatcccagtcaacctgccacatgcagtg
acccgtgacattaaattcagaaactatgtcatccccaagggcacaactgtactaatatca
ctgacttctgtgctacgtgatgacaaagaatttcccaacccagagacatttgaccctgcc
catttcctggatgatagtggcaactttaagaagagtgactacttcatggttttctcagca
ggaaaacggatttgtgtgggagaaagcctggcccgtatggagctgtttttattcctgacc
tccattttacaaaattttaccctgaaacctgtggtcgacataaaggaccttgacaccacc
ccagttgccagtgggtttggacatatcccacccccctacaagatttgctttgttcctttg
tga

DBGET integrated database retrieval system