KEGG   Felis catus (domestic cat): 101089411Help
Entry
101089411         CDS       T02385                                 

Gene name
KLHL36, USP10
Definition
(RefSeq) kelch-like protein 36
  KO
K11841  
ubiquitin carboxyl-terminal hydrolase 10 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101089411 (KLHL36)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101089411 (KLHL36)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101089411 (KLHL36)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E2
AA seq 646 aa AA seqDB search
MMEGSRQTRVSRPYKISESSKVYHWADHSTTVLQRLNEQRLRGLFCDIVLVADEQRVPAH
RNLLAVCSDYFNSMFTIGMREAFQKEVELVGASYIGLKAVVDFLYGGELALDGGNIDYIL
ETAHLLQIWTAVDFCCEYLEQEVSEDNYLYLQELASIYSLKRLDAFIDGFILSRFGTLSF
TPDFLQNVSMQKLCVYLSSSQVQRECEHDLLQAALQWLTQQPEREAHAYQVLENIHFPLI
PKNDLLHRVKPAVCSLLPREANCEGFIEEAVRYHNSLAAQPVMQTKRTALRTNEERLLFV
GGEVSERCLELSDDTCYLDAKSEQWVKETPLPARRSHHCVAVLGGFIFIAGGSFSRDNGG
DAASNLLYRYDPRCKQWIKVASMNQRRVDFYLASIEDMLVAVGGRNENGALSSVETYSPK
TDSWSYVAGLPRFTYGHAGAIYKDFVYISGGHDYQIGPYRKNLLCYDHRTDVWEERRPMT
TARGWHSMCSLGDSIYSIGGSDDSIESMERFDVLGVEAYSPQCNQWTRVAPLLHANSESG
VAVWQGRIYVLGGYSWESTAFSKTVQVYDRDKDAWSRGTDLPKAIAGVSACVCALKPRLE
DKKKKGKGKRHQDRGQRPRPPPPPLGLEGPRAPPPPAGGRRPATTP
NT seq 1941 nt NT seq  +upstreamnt  +downstreamnt
atgatggagggaagccggcagacgcgagtgtcacggccgtacaagatcagcgaatcttca
aaggtgtaccactgggccgaccactcgaccacggtgctgcagcggctgaacgagcagcgt
ctccgcggcctcttctgcgacatcgtcctggtggcggacgagcagcgcgtgccggcccac
cgcaacctgctggccgtgtgcagcgactacttcaactccatgttcaccatcggcatgcgc
gaggccttccagaaggaggtggagctcgtgggcgcctcctacatcgggctcaaggccgtg
gtggacttcctgtacggcggggagctggcgctggacggcggcaacatcgactacatcctg
gagacggcgcacctgctgcagatctggacggcggtggacttctgctgcgagtacctggag
caggaggtgagcgaggacaactacctgtacctgcaggagctggcctccatctacagcctc
aagcggctcgacgccttcatcgacggcttcatcctgagccgcttcggcacgctgtccttc
acgcccgacttcctgcagaacgtctccatgcagaagctgtgcgtctacctgagcagcagc
caggtgcagcgggagtgcgagcacgacctgctgcaggccgccctgcagtggctgacgcag
cagccggagcgcgaggcccacgcctaccaggtgctggagaacatccacttcccgctcatc
cccaagaacgacctgctgcaccgcgtcaagccggccgtgtgctcgctgctgccccgcgag
gccaactgcgagggcttcatcgaggaggcggtgcgctaccacaacagcctggcggcccag
ccggtcatgcagaccaagcgcacggcgctccgcaccaacgaggagcgcctcctgttcgtg
ggcggcgaggtctccgagcggtgtctggagctcagcgatgacacctgctacctggacgcc
aagagcgagcagtgggtcaaggagacgcccctgccggcccggcggagccaccactgcgtc
gccgtgctgggggggttcatcttcattgccggcggcagcttctcccgggacaacggaggg
gatgcggcgtccaatcttctttataggtatgacccccgctgtaaacagtggatcaaggtg
gcctccatgaaccagcgccgtgtggacttctacctggcctccatcgaagacatgctggtg
gccgtcggtggccggaacgagaacggagctctttcttcagtggagacttacagccccaag
accgactcctggtcctacgtggccggcttgccgaggttcacctacggccacgcgggcgcc
atctacaaggacttcgtgtacatctcgggggggcacgactaccagatcggcccctaccgc
aagaacctgctgtgctacgaccaccggacggacgtgtgggaggagcggcggcccatgacc
acggcgcgcggctggcacagcatgtgcagcctgggcgacagcatctactccatcggcggc
agcgacgacagcatcgagtccatggagcgcttcgacgtgctgggcgtggaggcctacagc
ccgcagtgcaaccagtggacccgcgtggcgcccctgctgcacgccaacagcgagtcgggc
gtggccgtgtggcagggccgcatctacgtcctgggcggctacagctgggagagcacggcc
ttctccaagaccgtgcaggtctacgaccgcgacaaggacgcgtggagcaggggcaccgac
ctgcccaaggccatcgccggcgtgtccgcctgcgtgtgcgccctgaagccgcggctggag
gacaagaagaagaagggcaagggcaagaggcaccaggaccggggccagcgaccccgcccc
ccgcccccccctctgggcctcgaggggccccgggccccgccgccccccgccggaggccgt
agaccagccacgaccccgtag

DBGET integrated database retrieval system