KEGG   Felis catus (domestic cat): 101089411Help
Entry
101089411         CDS       T02385                                 

Definition
(RefSeq) ubiquitin carboxyl-terminal hydrolase 10 isoform X1
  KO
K13958  
kelch-like protein 36
Organism
fca  Felis catus (domestic cat)
Brite
Ubiquitin system [BR:fca04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101089411
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
E2
AA seq 812 aa AA seqDB search
MMEGSRQTRVSRPYKISESSKYIFGDFSPDEFNQFFVTPRSSVELPPYNGTVLCGTQAPD
ELPDGQEYQRIEFGVNEVIEPNDTLPRTPNYSISSTLNPQAPEFILSCTTSKKIPDDVDK
EAAYSSVDCQYPGSALALDGSSSVEVEVLENDGVAGGLGQRERKKKKKRPPGYYSYLKDG
GEGSIPTDALVNGHANPAVPNSVGSEDVELAGAAPPSGTPRTCGSPRGSTDFVGDAVSGG
PFPGALDGDARTAGQPGSCHGADLEQSCLPAEAGRDSLLRTAVAQPYTGTHTTENLAVAN
GQILESSGEGSAANGVELHTVESPDSDAAKAESAAPAADAPASVAGTAPASQPKSWASLF
HDSKPSSSSPVASVETKYSPPATSPLVSEKQVEVKEGLVPVSEDPVAIKIAELLENVTLI
HKPVSLQPRGLINKGNWCYINATLQALVACPPMYHLMKFIPLYSKVQRPCTSTPMIDSFV
RLMNEFTNMPVPPKPRQALGDKIVRDIRPGAAFEPTYIYRLLTVIKSSLSEKGRQEDAEE
YLGFILNGLHEEMLNLKKLLSPNNQKLTVSNGPRSPSVHEDEQDEPGEGSEDEWEQVGPR
SKTSVTRQAEFVQTPITGIFGGHIRSVVYQQSSRESATLQPFFTLQLDIQSDKIRTVQDA
LESLVARESVQGYTTKTKQEVEISRRVTLEKLPPVLVLHLKRFVYEKTGGCQKLVKSVEY
PVDLEISKELLSPGVKNKNFKCHRTYRLFAVVYHHGSSATGGHYTTDVFQIGLNGWLRID
DQTVKVVNQYQVVKPTAERTAYLLYYRRVDLL
NT seq 2439 nt NT seq  +upstreamnt  +downstreamnt
atgatggagggaagccggcagacgcgagtgtcacggccgtacaagatcagcgaatcttca
aagtatatttttggagactttagccctgatgaattcaatcagttctttgtgactcctcgc
tcttcagttgagcttcctccctacaatggaacagttctgtgtggcacacaagctcccgat
gaactacccgatggacaagaatatcagagaattgagtttggtgttaatgaagtaattgaa
cctaacgacactttgccgagaactcccaactacagtatttcaagcacattgaatcctcag
gcccctgaatttatcctcagttgcacaacttccaaaaagatccctgatgacgtagataaa
gaagcggcctacagctccgtggactgccagtacccaggctctgcccttgctctggacggc
agctctagcgtggaggtggaagttctagaaaacgacggtgtcgcgggtggtctcggacag
agggagcgtaaaaagaagaaaaaacgtccaccaggatattacagttacttgaaagatggc
ggtgaggggagtattcccacagacgccctggtcaatggccacgccaacccagcggtcccg
aacagcgtaggctcagaggatgtggagttagcgggcgcggcgcccccatcggggacaccc
aggacttgcggcagccctcggggttccacggacttcgtcggcgacgctgtgtccggcggg
cctttccctggagccctcgacggcgatgcgaggactgcagggcagcccgggagctgccac
ggggctgacttggaacagtcctgcctccccgcagaggccggcagggacagcctgttgagg
acagcggtggctcagccttacacggggactcacactactgaaaaccttgccgttgctaat
ggacaaatacttgaatcctcgggcgagggctcagctgccaatggggtcgagttgcacact
gtggaaagcccggactcggacgctgctaaagccgagagcgccgcccctgctgccgatgcc
ccggcctctgtggcgggcaccgctcccgccagccagcctaagtcgtgggccagtcttttt
catgattctaagccctcttcctcctcgcccgtggcttccgtggaaactaagtattcccct
cccgccacgtcccccctggtctctgaaaagcaggtcgaagtcaaagaagggcttgttccg
gtttcagaggatcccgtagccataaagattgcagagttactggagaatgtgaccctaata
cataaaccagtgtcattgcaaccccgggggctgatcaataaaggaaactggtgctacatt
aatgctacgctgcaggcactggtcgcctgccctccaatgtatcacctgatgaagttcatc
cctctgtattcgaaagtgcaaaggccttgtacgtcgacacccatgatagatagctttgtt
cggctaatgaatgagtttactaatatgccagtacctccaaaacccagacaagctcttggg
gataaaatcgtgagggatatccgccctggagctgcttttgaacctacgtacatttacaga
ctcctgacggtgatcaagtcgagcctgtctgaaaagggtcgacaagaagacgcggaggaa
tatttaggcttcattctaaacggacttcatgaggaaatgctgaacctgaagaaacttctg
tcacccaataaccaaaaactcactgtttccaacggacccaggagcccgtcggtgcacgaa
gacgagcaggacgagccgggcgaaggcagtgaggacgagtgggagcaagtgggccccagg
agcaagacttcagtcacgcgccaggcggagtttgttcagaccccgatcactggcattttt
ggcggacacatcaggtctgtggtctaccagcagagttccagagaatccgccactttgcag
cccttcttcacgctgcagctggacatccagtctgacaagatacgtacggtccaggacgct
ttggagagcctggtggcgagagaatctgtccagggttataccacaaagaccaaacaagag
gtggagataagtcgaagagtgactctggagaagctccctcccgtgctcgtgctgcacctg
aagcggtttgtctacgagaagaccggcgggtgtcagaagctcgtcaagagcgtcgagtac
cctgtggacctggagatcagcaaagaactgctttctccaggggttaaaaataagaatttt
aaatgccacagaacctataggctatttgcagtggtctaccatcacggcagcagcgcgacg
ggcggccactataccacggacgtcttccagatcggtctgaacggctggctgcgcatcgat
gaccagacggtcaaggtggtgaaccagtaccaggtggtgaagcccactgccgaacgcaca
gcctacctcctgtattaccgccgcgtggacctgctgtag

DBGET integrated database retrieval system