KEGG   Felis catus (domestic cat): 101089554Help
Entry
101089554         CDS       T02385                                 

Gene name
USP22
Definition
(RefSeq) ubiquitin specific peptidase 22
  KO
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.4.19.12]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     101089554 (USP22)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101089554 (USP22)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101089554 (USP22)
Ubiquitin system [BR:fca04121]
 Deubiquitinating enzyme (DUB)
  Ubiquitin-specific proteases (UBPs)
   UBP/USP
    101089554 (USP22)
Chromosome [BR:fca03036]
 Eukaryotic Type
  Histone modification proteins
   HAT complexes
    SAGA complex
     101089554 (USP22)
    SLIK complex
     101089554 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
Ensembl: 
Position
E1
AA seq 494 aa AA seqDB search
MEAQRIWEPGGFLFQGCGGSLVPGRQAKSCVCHVCGVHLNRLHSCLHCVFFGCFTKKHIH
EHAKSKRHNLAIDLMYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEPT
KRELELLKHNPKRRKITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRC
EMQSPSSCLVCEMSSLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAAL
DVLHRHCKGDDNGKKANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDL
PGSSTPFWPLSPGSEGSVVNGESHVAGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQE
STKQLTMKKLPIVACFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQ
QPTDSLNNDNKYSLFAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIEDVLDSE
GYLLFYHKQFLEYE
NT seq 1485 nt NT seq  +upstreamnt  +downstreamnt
atggaagcccagaggatctgggaaccgggaggttttctcttccagggttgcggtggaagc
ttggtccctgggaggcaggcaaagtcgtgtgtgtgtcacgtctgtggtgtccacctgaac
aggctccactcctgcctgcactgcgtcttctttggctgtttcacaaagaaacatattcac
gagcatgcgaagtccaagcggcacaacctggccatagatctcatgtatggagggatctac
tgctttttgtgtcaggactacatatatgacaaagacatggaaatcattgccaaagaggaa
cagcggaaggcttggaaaatgcaaggcgttggggagaagttttcaacttgggaaccaacc
aaacgggagcttgaactgctgaaacacaacccgaaaaggcgaaagatcacctctaactgc
accataggtctgcgggggctgatcaaccttggaaacacgtgcttcatgaactgcatcgtc
caggctctcacccacacgccgctcctgcgggacttcttcctctccgacaggcaccggtgt
gaaatgcagagccccagctcgtgtctggtgtgcgagatgtcctcgctttttcaggagttt
tactctgggcaccggtccccccacatcccatacaagctgctgcacctggtgtggactcac
gcccggcacctggcggggtacgagcagcaggacgcccacgaattcctcatcgcggcgctg
gacgtcctgcaccggcactgcaaaggtgatgacaacgggaagaaggccaacaaccccaac
cactgcaactgcatcatagaccagatcttcacgggcggactgcagtcggacgtcacctgc
caagtctgccatggagtctccaccaccatcgaccccttctgggacatcagtttagacctg
cctggctcttccaccccgttctggcccctgagcccaggcagcgagggcagcgtggtgaac
ggagaaagccacgtagcgggaaccactacgctcacggactgcttgcgaagattcacgaga
ccagagcacttaggaagcagcgccaagatcaagtgtagcggctgccatagctaccaggag
tccactaagcagctcaccatgaagaaactgcccatcgtagcctgctttcatctcaaacga
tttgaacactcggccaaactgaggaggaagatcaccacctatgtgtcctttcccctggaa
ctggacatgacccccttcatggcgtccagcaaagagagcaggatgaacggacagtaccag
cagccaacggatagtctcaataatgacaataagtactccctgtttgcggtagttaaccac
caagggaccttggagagcggccactacaccagcttcatccggcagcacaaggatcagtgg
ttcaaatgtgacgatgccatcatcaccaaggccagcatcgaggacgtgctggacagcgag
gggtacctgctgttctaccacaaacagttcctggaatacgagtag

DBGET integrated database retrieval system