KEGG   Felis catus (domestic cat): 101089554Help
Entry
101089554         CDS       T02385                                 

Gene name
USP22
Definition
ubiquitin specific peptidase 22
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     101089554 (USP22)
Peptidases [BR:fca01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   101089554 (USP22)
Transcription machinery [BR:fca03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     101089554 (USP22)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
E1
AA seq 480 aa AA seqDB search
MRWLLILFSRFQAKSCVCHVCGVHLNRLHSCLHCVFFGCFTKKHIHEHAKSKRHNLAIDL
MYGGIYCFLCQDYIYDKDMEIIAKEEQRKAWKMQGVGEKFSTWEPTKRELELLKHNPKRR
KITSNCTIGLRGLINLGNTCFMNCIVQALTHTPLLRDFFLSDRHRCEMQSPSSCLVCEMS
SLFQEFYSGHRSPHIPYKLLHLVWTHARHLAGYEQQDAHEFLIAALDVLHRHCKGDDNGK
KANNPNHCNCIIDQIFTGGLQSDVTCQVCHGVSTTIDPFWDISLDLPGSSTPFWPLSPGS
EGSVVNGESHVAGTTTLTDCLRRFTRPEHLGSSAKIKCSGCHSYQESTKQLTMKKLPIVA
CFHLKRFEHSAKLRRKITTYVSFPLELDMTPFMASSKESRMNGQYQQPTDSLNNDNKYSL
FAVVNHQGTLESGHYTSFIRQHKDQWFKCDDAIITKASIEDVLDSEGYLLFYHKQFLEYE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atgcgctggctcctaattctcttctctcgatttcaggcaaagtcgtgtgtgtgtcacgtc
tgtggtgtccacctgaacaggctccactcctgcctgcactgcgtcttctttggctgtttc
acaaagaaacatattcacgagcatgcgaagtccaagcggcacaacctggccatagatctc
atgtatggagggatctactgctttttgtgtcaggactacatatatgacaaagacatggaa
atcattgccaaagaggaacagcggaaggcttggaaaatgcaaggcgttggggagaagttt
tcaacttgggaaccaaccaaacgggagcttgaactgctgaaacacaacccgaaaaggcga
aagatcacctctaactgcaccataggtctgcgggggctgatcaaccttggaaacacgtgc
ttcatgaactgcatcgtccaggctctcacccacacgccgctcctgcgggacttcttcctc
tccgacaggcaccggtgtgaaatgcagagccccagctcgtgtctggtgtgcgagatgtcc
tcgctttttcaggagttttactctgggcaccggtccccccacatcccatacaagctgctg
cacctggtgtggactcacgcccggcacctggcggggtacgagcagcaggacgcccacgaa
ttcctcatcgcggcgctggacgtcctgcaccggcactgcaaaggtgatgacaacgggaag
aaggccaacaaccccaaccactgcaactgcatcatagaccagatcttcacgggcggactg
cagtcggacgtcacctgccaagtctgccatggagtctccaccaccatcgaccccttctgg
gacatcagtttagacctgcctggctcttccaccccgttctggcccctgagcccaggcagc
gagggcagcgtggtgaacggagaaagccacgtagcgggaaccactacgctcacggactgc
ttgcgaagattcacgagaccagagcacttaggaagcagcgccaagatcaagtgtagcggc
tgccatagctaccaggagtccactaagcagctcaccatgaagaaactgcccatcgtagcc
tgctttcatctcaaacgatttgaacactcggccaaactgaggaggaagatcaccacctat
gtgtcctttcccctggaactggacatgacccccttcatggcgtccagcaaagagagcagg
atgaacggacagtaccagcagccaacggatagtctcaataatgacaataagtactccctg
tttgcggtagttaaccaccaagggaccttggagagcggccactacaccagcttcatccgg
cagcacaaggatcagtggttcaaatgtgacgatgccatcatcaccaaggccagcatcgag
gacgtgctggacagcgaggggtacctgctgttctaccacaaacagttcctggaatacgag
tag

DBGET integrated database retrieval system