KEGG   Felis catus (domestic cat): 101089760Help
Entry
101089760         CDS       T02385                                 

Gene name
RAE1
Definition
ribonucleic acid export 1
Orthology
K14298  
mRNA export factor
Organism
fca  Felis catus (domestic cat)
Pathway
RNA transport
Influenza A
Module
Nuclear pore complex
Brite
KEGG Orthology (KO) [BR:fca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    101089760 (RAE1)
 Human Diseases
  Infectious diseases
   05164 Influenza A
    101089760 (RAE1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
A3
AA seq 368 aa AA seqDB search
MSLFGTTSGFGTSGTSMFGSTSTDNHNPMKDIEVTSSPDDSIGCLSFSPPTLPGNFLIAG
SWANDVRCWEVQDSGQTIPKAQQMHTGPVLDVCWSDDGSKVFTASCDKTAKMWDLNSNQA
IQIAQHDAPVKTIHWIKAPNYSCVMTGSWDKTLKFWDTRSSNPMMVLQLPERCYCADVIY
PMAVVATAERGLIVYQLENQPSEFRRIESPLKHQHRCVAIFKDKQNKPTGFALGSIEGRV
AIHYINPPNPAKDNFTFKCHRSNGTNTSAPQDIYAVNGIAFHPVHGTLATVGSDGRFSFW
DKDARTKLKTSEQLDQPISACCFNHNGNIFAYASSYDWSKGHEFYNPQKKNYIFLRNAAE
ELKPRNKK
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttcggaacaacctcgggtttcggaaccagtgggaccagcatgtttggcagc
acaagcacagataaccacaaccccatgaaggatattgaagtaacatcgtctcctgatgat
agcattggttgtctatcttttagcccaccaaccttgcccgggaactttcttattgcagga
tcgtgggctaatgatgttcgctgctgggaagttcaagacagcggacagacgatcccaaaa
gcccagcagatgcatacggggccggtgttagatgtctgctggagtgatgatgggagcaaa
gtatttacagcatcatgtgataaaactgccaaaatgtgggacctcaacagcaatcaagca
atacagattgcacagcacgacgctcctgttaagaccatccattggatcaaagctccaaac
tacagctgtgtgatgactggcagctgggataagactttgaagttttgggatacacgatca
tcaaatcccatgatggttttgcaactccccgaaagatgttactgcgccgatgtgatctac
cctatggccgtggtggcgactgcagagaggggactgatcgtctaccagttagagaatcag
ccctccgaattcaggaggatagaatccccgctgaaacatcagcatcgatgcgtggctatt
ttcaaagacaaacagaacaagccgactggtttcgctctgggaagtatcgaggggagggtt
gctattcactacatcaaccccccaaatcctgccaaagacaacttcaccttcaaatgtcac
cgctcgaacggaaccaatacctcagctcctcaagacatctacgcggtaaacgggatcgcg
ttccatcctgttcacggcacccttgccactgtgggatccgacggcagattcagcttttgg
gacaaagatgccagaacgaaactaaaaacttcggaacagttagatcagcccatatcggcc
tgctgcttcaatcacaacgggaacatatttgcctatgcttccagctacgactggtcaaag
ggacatgaattttataatccccaaaagaaaaattacatcttcctgcgtaacgcagccgaa
gaactaaaacccaggaataagaagtag

DBGET integrated database retrieval system