KEGG   Felis catus (domestic cat): 101089898Help
Entry
101089898         CDS       T02385                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Class
Metabolism; Overview; Carbon metabolism [PATH:fca01200]
Metabolism; Overview; Fatty acid metabolism [PATH:fca01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:fca00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:fca00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:fca00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:fca00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:fca00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:fca00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:fca00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:fca00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D2
AA seq 297 aa AA seqDB search
MSEGMNEKYCSIILLPGHFNPQIKDSWCPKLQKMAAGADFQYLITEKKGKDGNVGLIQLN
RPKALNALCNGLMMELNQALDAFEEDPAVGAIVLTGGEKAFAAGADIKEMQSRTFQDCYS
SMFLSHWDRLARVKKPVIAAVNGYALGGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGA
GGTQRLTRAVGKSLAMEMVLTGDRISAQDAKQAGLVSKIFPVETLVEEAIRCAEKIASNS
KIIAAMAKESVNAAFEMTLTEGNKLEKKLFYSTFATEDRKEGMTAFVEKRKASFKDQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagggtatgaatgagaaatactgcagtatcattctcctgcctggacacttcaac
ccacagattaaagactcttggtgtcccaaactccagaaaatggctgctggtgctgacttt
cagtacctcatcacagaaaagaaggggaaggacggcaacgtggggctgatccaactgaac
cgccccaaagcactcaacgcgctctgcaatggcctgatgatggagctcaaccaggcactg
gacgcctttgaggaggaccccgctgtgggggccatcgtcctcacgggtggggagaaggca
tttgcagctggagccgacatcaaggagatgcagagccgaacgttccaggactgttactcc
agcatgtttttgagccactgggaccgacttgcccgggttaagaagccagtcatagctgct
gtcaatggctatgcccttggtggcggctgcgaacttgctatgatgtgtgacatcatttat
gccggagagaaagcccagtttgcgcagccggaaatcctactaggaaccatcccaggtgca
gggggcacccagagactgacccgtgctgttggaaagtcactggccatggagatggtcctc
actggtgaccggatctctgcccaggatgccaagcaagcaggtcttgtaagcaaaattttt
cctgtggagacactggtcgaagaagccatccggtgtgcggagaaaatcgccagcaattcc
aaaatcatagcagcaatggccaaagagtccgtgaatgcagcttttgaaatgacattaaca
gagggaaacaagttggagaagaagctcttctattcaacgttcgctactgaagaccggaag
gaagggatgactgcgtttgtggaaaagagaaaggccagtttcaaagaccagtga

DBGET integrated database retrieval system