KEGG   Felis catus (domestic cat): 101089898Help
Entry
101089898         CDS       T02385                                 

Gene name
ECHS1
Definition
enoyl CoA hydratase, short chain, 1, mitochondrial
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
fca  Felis catus (domestic cat)
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Carbon metabolism
Fatty acid metabolism
Module
Malonate semialdehyde pathway, propanoyl-CoA => Acetyl-CoA
Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
Fatty acid biosynthesis, elongation, mitochondria
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    101089898 (ECHS1)
   01212 Fatty acid metabolism
    101089898 (ECHS1)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    101089898 (ECHS1)
   00650 Butanoate metabolism
    101089898 (ECHS1)
  Lipid metabolism
   00062 Fatty acid elongation
    101089898 (ECHS1)
   00071 Fatty acid degradation
    101089898 (ECHS1)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    101089898 (ECHS1)
   00310 Lysine degradation
    101089898 (ECHS1)
   00380 Tryptophan metabolism
    101089898 (ECHS1)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    101089898 (ECHS1)
Enzymes [BR:fca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     101089898 (ECHS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D2
AA seq 271 aa AA seqDB search
MEIPLSPLTPGADFQYLITEKKGKDGNVGLIQLNRPKALNALCNGLMMELNQALDAFEED
PAVGAIVLTGGEKAFAAGADIKEMQSRTFQDCYSSMFLSHWDRLARVKKPVIAAVNGYAL
GGGCELAMMCDIIYAGEKAQFAQPEILLGTIPGAGGTQRLTRAVGKSLAMEMVLTGDRIS
AQDAKQAGLVSKIFPVETLVEEAIRCAEKIASNSKIIAAMAKESVNAAFEMTLTEGNKLE
KKLFYSTFATEDRKEGMTAFVEKRKASFKDQ
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggaaatccctttgtcccctctcaccccaggtgctgactttcagtacctcatcacagaa
aagaaggggaaggacggcaacgtggggctgatccaactgaaccgccccaaagcactcaac
gcgctctgcaatggcctgatgatggagctcaaccaggcactggacgcctttgaggaggac
cccgctgtgggggccatcgtcctcacgggtggggagaaggcatttgcagctggagccgac
atcaaggagatgcagagccgaacgttccaggactgttactccagcatgtttttgagccac
tgggaccgacttgcccgggttaagaagccagtcatagctgctgtcaatggctatgccctt
ggtggcggctgcgaacttgctatgatgtgtgacatcatttatgccggagagaaagcccag
tttgcgcagccggaaatcctactaggaaccatcccaggtgcagggggcacccagagactg
acccgtgctgttggaaagtcactggccatggagatggtcctcactggtgaccggatctct
gcccaggatgccaagcaagcaggtcttgtaagcaaaatttttcctgtggagacactggtc
gaagaagccatccggtgtgcggagaaaatcgccagcaattccaaaatcatagcagcaatg
gccaaagagtccgtgaatgcagcttttgaaatgacattaacagagggaaacaagttggag
aagaagctcttctattcaacgttcgctactgaagaccggaaggaagggatgactgcgttt
gtggaaaagagaaaggccagtttcaaagaccagtga

DBGET integrated database retrieval system