KEGG   Felis catus (domestic cat): 101089928Help
Entry
101089928         CDS       T02385                                 

Gene name
MGLL
Definition
(RefSeq) monoglyceride lipase isoform X1
  KO
K01054  
acylglycerol lipase [EC:3.1.1.23]
Organism
fca  Felis catus (domestic cat)
Pathway
Glycerolipid metabolism
Metabolic pathways
Retrograde endocannabinoid signaling
Regulation of lipolysis in adipocytes
Module
Acylglycerol degradation
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    101089928 (MGLL)
 Organismal Systems
  Endocrine system
   04923 Regulation of lipolysis in adipocyte
    101089928 (MGLL)
  Nervous system
   04723 Retrograde endocannabinoid signaling
    101089928 (MGLL)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.23  acylglycerol lipase
     101089928 (MGLL)
Peptidases [BR:fca01002]
 Serine Peptidases
  Family S33
   101089928 (MGLL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
A2
AA seq 369 aa AA seqDB search
MPPCDRRDEGTALICLALILHAVVVVECKSQDMMETGLGDPFRMPEESSPRQTPQSVPYQ
DLPHLVNADGQYLFCRYWKPTGTPKALIFVSHGAGEHCGRYDELAQMLVGLELLVFAHDH
VGHGQSEGERMVVSDFHVFIRDVLQHVDVMQKDYPGLPVFLLGHSMGGAITILTAAERPG
LFSGMVLISPLVLASPESATTFKDYPKSVVKMATRVAFSSISTSYWVFAAKILNLVLPNM
SLGPIDSSMLSRNKTEVDIYNADPLICRAGLKVCFGNQLLNAVTRVERALPKLTLPFLLL
QGSADRLCDSKGAYLVMESTKSQDKTLKIYEGAYHVLHKELPEVTNSVFHEINMWVSQRT
AAAGKRSPL
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgccgccctgtgaccgccgagatgagggaacagcccttatttgcctggctctgattctc
catgctgtcgtggttgtggaatgcaaaagccaggacatgatggaaacaggacttggagat
cctttcagaatgccggaggaaagttctcccaggcagaccccacagagcgttccataccag
gacctgcctcacctggtcaatgccgatggacagtacctcttctgcaggtactggaaacct
acgggcacacccaaggccctcatctttgtgtcccatggagccggggagcactgtggccgc
tatgacgagctggctcagatgctggtggggctcgagctgctggtgttcgcccacgaccat
gttggccatggacagagcgaaggggagaggatggtagtgtctgacttccacgttttcatc
agggatgtgctacagcacgtggatgtcatgcagaaagactacccggggcttcctgtgttc
ctgctgggccactccatgggaggtgccatcaccatccttacggccgcagagagaccgggc
ctcttctccggcatggtcctcatttcgcctttggttcttgccagtcctgagtctgcaaca
actttcaaggattatccgaagagcgtggtcaaaatggcgacgagagtggcattctcttca
atttcaacttcttattgggtctttgctgcgaaaattctcaaccttgtcctgccaaacatg
tccctgggcccaatcgactccagcatgctctctcggaataagacggaggtcgacatttat
aatgcggaccccctcatctgccgggcgggactgaaggtgtgcttcggcaaccagctgctc
aatgccgtcacgcgggtggagcgggccctccccaagctgaccttgcccttcctgctgctc
cagggctctgccgaccgcctttgtgacagcaaaggggcctacctggtcatggagtccacc
aagagccaggacaagacactcaagatttacgaaggtgcctaccacgttctccacaaagag
cttccagaagtaaccaactccgtcttccacgaaataaacatgtgggtctcccaaaggaca
gcagccgcgggaaagcggtccccgctctga

DBGET integrated database retrieval system