KEGG   Felis catus (domestic cat): 101089929Help
Entry
101089929         CDS       T02385                                 

Gene name
CPA1
Definition
carboxypeptidase A1 (pancreatic)
Orthology
K08779  
carboxypeptidase A1 [EC:3.4.17.1]
Organism
fca  Felis catus (domestic cat)
Pathway
Pancreatic secretion
Protein digestion and absorption
Brite
KEGG Orthology (KO) [BR:fca00001]
 Organismal Systems
  Digestive system
   04972 Pancreatic secretion
    101089929 (CPA1)
   04974 Protein digestion and absorption
    101089929 (CPA1)
Enzymes [BR:fca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.17  Metallocarboxypeptidases
    3.4.17.1  carboxypeptidase A
     101089929 (CPA1)
Peptidases [BR:fca01002]
 Metallo Peptidases
  Family M14: carboxypeptidase A family
   101089929 (CPA1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
Position
A2
AA seq 426 aa AA seqDB search
MFPAGRSMRGLLIWSVLLGAVLGKEDFVGHQVLRISAADEAQVQKVKELEDLEHLQLDFW
RGPGQPGSPIDVRVPFPSIQAVKAFLEAHGLGYTIMIEDVQSLLDEEQEQMFAFQARSRS
TDTFNYATYHTLEEIYGFMDLLVAEHPQLVSKLQIGNTYEGRPIYVLKFSTGGNNRPAIW
IDTGIHSREWVTQASGVWFAKKITQDYGQDFTLTAILDSMDIFLEIVTNPDGFAFTHSKN
RMWRKTRSLTPGSSCVGVDPNRNWDAGFGMPGASSNPCTDTYRGKFANSEVEVKSIVDFV
KSHGNIKAFVSIHSYSQLLLYPYGYKAEPAPNRDELDQLAKSAVTALASLYGTKFKYGSI
IKTIYQASGSTIDWTYSQGIKYSFTFELRDTGRYGFLLPASQIVPTAQETWLALRTIMEY
TLNHPY
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgttcccagctggccgcagcatgagggggctgctgatttggagtgtgctgctaggggct
gtccttggcaaagaggactttgtggggcaccaggtgctccgaatctctgctgccgatgaa
gcccaggtccagaaggtgaaggagctggaggacctcgagcacctgcagctggacttctgg
cggggccctggccagcccggctctcccatcgacgtccgagtgcccttccccagcatccag
gctgtcaaggccttcctggaggcccacggcctcgggtacacgatcatgattgaggacgtg
cagtcgttgctggatgaggagcaggagcagatgttcgccttccaggcccggtcccgctcc
accgacaccttcaactacgccacctaccacaccctggaggagatctacggcttcatggat
ctgctggtggccgagcacccacagcttgtgagcaagctccagatcggcaacacctacgag
gggcgtcccatctatgtgctgaagttcagcaccgggggcaacaaccgtcccgccatctgg
atcgacacggggatccattcccgggagtgggttacccaggccagcggggtctggtttgcc
aagaagatcacacaagactatggccaggacttcactctcactgccattcttgattccatg
gacatcttcctggagattgtcactaaccctgatggttttgccttcacccacagcaagaat
cgcatgtggcgcaagactcgatccctcacaccgggctcctcctgtgttggggtggacccc
aaccggaactgggacgctggctttgggatgcccggagccagcagcaacccctgcacggac
acttaccggggcaagtttgcaaattccgaagtggaggtcaagtccatcgtggactttgtg
aagagccacgggaacatcaaggccttcgtctccatccacagctactcccagctcctcctg
tatccctacggctacaaggcagagccagcccccaaccgggacgagctggatcagctggcc
aagtctgctgtgacggccctggcctctctgtatgggaccaagttcaagtacggcagcatc
atcaaaacgatttaccaagccagcggaagcaccattgactggacctacagccagggcatc
aagtactccttcaccttcgagctccgggacacggggcgctatggcttcctgctgccggcc
tcccagatcgtccccacggcccaggagacgtggctggcgcttcggaccatcatggaatac
accctgaatcacccctactga

DBGET integrated database retrieval system