KEGG   Felis catus (domestic cat): 101090141Help
Entry
101090141         CDS       T02385                                 

Gene name
GSTO2
Definition
(RefSeq) glutathione S-transferase omega 2
  KO
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Platinum drug resistance
Chemical carcinogenesis
Fluid shear stress and atherosclerosis
Brite
KEGG Orthology (KO) [BR:fca00001]
 Metabolism
  Metabolism of other amino acids
   00480 Glutathione metabolism
    101090141 (GSTO2)
  Xenobiotics biodegradation and metabolism
   00980 Metabolism of xenobiotics by cytochrome P450
    101090141 (GSTO2)
   00982 Drug metabolism - cytochrome P450
    101090141 (GSTO2)
 Human Diseases
  Cancers
   05204 Chemical carcinogenesis
    101090141 (GSTO2)
  Cardiovascular diseases
   05418 Fluid shear stress and atherosclerosis
    101090141 (GSTO2)
  Drug resistance
   01524 Platinum drug resistance
    101090141 (GSTO2)
Enzymes [BR:fca01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     101090141 (GSTO2)
Transporters [BR:fca02000]
 Other Transporters
  Pores ion channels [TC:1]
   101090141 (GSTO2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
Ensembl: 
Position
D2
AA seq 209 aa AA seqDB search
MEDATRTFGKGSCPPGPVPEGLIRVYSMRFCPFAHRTRLVLRAKGIRHEVININLRNKPE
WYYTKHPFGQIPVLENSKCQLIYESVIACEYLDDAYPGRKLYPYDPYERARQKMLLELFY
KILGYQNTIFFGGDCISMIDYLFWPWFERLDVYGIADCLNHTPALRLWTAAMKQDPTVCA
LLIDRSIFLGFLNLYFQNNPDAFDYGLTC
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggaggatgcgaccaggacctttgggaaaggaagctgccccccggggcccgtcccagag
ggcctgatccgcgtctacagtatgaggttctgcccctttgcgcacaggacgcgccttgtc
ctccgggccaaaggcatcagacatgaagtaatcaacattaacctgagaaacaagcctgaa
tggtactatacaaagcacccttttggccaaattcctgtcctggagaacagcaaatgtcag
ttgatctatgaatctgtcatcgcctgtgagtacctggatgatgcttatcctggaaggaag
ctgtatccatatgacccttatgagcgggctcgccagaagatgttattggagctattctat
aagattcttggctatcagaacaccatcttctttggtggagactgtatatccatgatcgat
tacctcttttggccctggtttgagcggctggatgtgtatggaatagctgactgtttgaac
cacacgccagctctccggctctggacagcagccatgaagcaggaccccacagtgtgcgcc
cttctcatagataggagcattttcctgggcttcttgaatctttattttcagaacaaccct
gatgcttttgattatgggctaacttgctga

DBGET integrated database retrieval system