KEGG   Felis catus (domestic cat): 101090141Help
Entry
101090141         CDS       T02385                                 

Gene name
GSTO2
Definition
glutathione S-transferase omega 2
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
fca  Felis catus (domestic cat)
Pathway
Glutathione metabolism
Metabolism of xenobiotics by cytochrome P450
Drug metabolism - cytochrome P450
Chemical carcinogenesis
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:fca00480]
Metabolism; Xenobiotics biodegradation and metabolism; Metabolism of xenobiotics by cytochrome P450 [PATH:fca00980]
Metabolism; Xenobiotics biodegradation and metabolism; Drug metabolism - cytochrome P450 [PATH:fca00982]
Human Diseases; Cancers; Chemical carcinogenesis [PATH:fca05204]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
D2
AA seq 216 aa AA seqDB search
MRFCPFAHRTRLVLRAKGIRHEVININLRNKPEWYYTKHPFGQIPVLENSKCQLIYESVI
ACEYLDDAYPGRKLYPYDPYERARQKMLLELFYKVPHLTKECLVAIRCGRECADLKLALR
QEFCNLEEILGYQNTIFFGGDCISMIDYLFWPWFERLDVYGIADCLNHTPALRLWTAAMK
QDPTVCALLIDRSIFLGFLNLYFQNNPDAFDYGLTC
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atgaggttctgcccctttgcgcacaggacgcgccttgtcctccgggccaaaggcatcaga
catgaagtaatcaacattaacctgagaaacaagcctgaatggtactatacaaagcaccct
tttggccaaattcctgtcctggagaacagcaaatgtcagttgatctatgaatctgtcatc
gcctgtgagtacctggatgatgcttatcctggaaggaagctgtatccatatgacccttat
gagcgggctcgccagaagatgttattggagctattctataaggtcccacatttgaccaag
gagtgtctggtggccataagatgtgggagagaatgtgctgatctgaagctagccctgcgt
caggaattctgcaaccttgaagagattcttggctatcagaacaccatcttctttggtgga
gactgtatatccatgatcgattacctcttttggccctggtttgagcggctggatgtgtat
ggaatagctgactgtttgaaccacacgccagctctccggctctggacagcagccatgaag
caggaccccacagtgtgcgcccttctcatagataggagcattttcctgggcttcttgaat
ctttattttcagaacaaccctgatgcttttgattatgggctaacttgctga

DBGET integrated database retrieval system