KEGG   Felis catus (domestic cat): 101090279Help
Entry
101090279         CDS       T02385                                 

Gene name
TESK2
Definition
testis-specific kinase 2
Orthology
K08842  
testis-specific kinase 2 [EC:2.7.12.1]
Organism
fca  Felis catus (domestic cat)
Brite
Enzymes [BR:fca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     101090279 (TESK2)
Protein kinases [BR:fca01001]
 Serine/threonine protein kinases: TKL group
  LISK family [OT]
   101090279 (TESK2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Ensembl: 
UniProt: 
Position
C1
AA seq 573 aa AA seqDB search
MDRSKRNSIAGFPPRVERLEDLEGGGGGDGNMTQVGRVWPSSYRALISAFSRLTRLDDFT
CEKIGSGFFSEVFKVRHRASGQVMALKMNTLSSNRANMLKEVQLMNRLSHPNILRFMGVC
VHQGQLHALTEYINSGNLEQLLDSNLHLPWTVRVKLAYDIAVGLSYLHFKGIFHRDLTSK
NCLIKRDENGYSAVVADFGLAEKIPDVSMGNEKLAVVGSPFWMAPEVLRDEPYNEKADVF
SYGIILCEIIARIQADPDYLPRTENFGLDYDAFQHMVGDCPPEFLQLTFNCCNMDPKLRP
SFAEIGKTLEEILSHLQEEELETDRKLQPTAKGLLEKGPGVKRLSSLDDKIPPKSPRPRR
TIWLSRSQSDIFSRKPPRTVNVLDPYYQPQRGGTVRTPKINPFSARQDLKGGKIKFFDLP
SKSVISLVFDLDAPGPGTLPLADWQEPLAPPARRWRSLPGSPEFLHQEACPFVGREDSLS
DGPPPRLSSLKYRVREIPPFRASALPPVLAHEAMDCSSPQEENGFGPRPQGASPCLAGAS
EEMEVEEERPRSLAPVPFSVSGVGLKTQGEQDG
NT seq 1722 nt NT seq  +upstreamnt  +downstreamnt
atggatcggagcaaacggaattcaattgcaggctttcctccacgtgtggagcgtcttgaa
gatcttgaaggaggtggtgggggagatgggaacatgacccaggtgggaagagtttggcca
tcttcatatcgagctcttataagtgccttttctagactgacgcgtttagatgacttcacc
tgtgaaaaaatagggtctggcttcttctctgaagtgttcaaggtgcgccatcgagcttct
ggccaggtgatggctcttaagatgaacacattgagcagtaaccgggcaaacatgctgaaa
gaagttcagcttatgaatagactctcccatcccaacatccttaggttcatgggtgtgtgt
gtacatcaaggacaattgcatgcacttacagagtatatcaactctggaaacctggaacaa
ttactagacagtaacctgcatttgccctggactgtgagggtgaaactggcctatgacata
gcagtgggcctcagctaccttcatttcaaaggcatttttcatcgggacctcacatctaag
aactgcctgataaagagggatgagaatggttactctgcagtggtagctgactttggcctg
gctgagaagattcctgacgtcagcatggggaatgagaagctggctgtggtgggctcaccc
ttctggatggcacctgaggttctccgagatgagccctacaatgaaaaggcggatgtgttc
tcttatggtatcatcctctgtgagatcatcgcccgcatccaagctgatccggactacctt
cctcgcacagagaacttcggattagactatgacgctttccagcatatggtgggagactgt
cccccagaatttctgcagctcaccttcaactgctgtaatatggaccccaaactacgccca
tcctttgcggagattgggaagaccttggaggaaattctgagccatctacaggaagaagag
ctggagacggacaggaagctgcagcccacagccaagggactcttggagaagggacctggt
gtaaagcgactgagctcactggatgacaagatccctcccaagtccccacgcccaagacgt
actatctggctgtctcgaagccagtcagacatcttttcccgtaagcccccacgtacagta
aacgtcttggacccctactaccagccacaacgaggtggtactgtccgcacccccaaaatc
aaccctttcagtgctcgacaggacctcaagggtggcaagatcaagttctttgacctgccc
agcaagtctgtcatctccctggtatttgacctagatgcaccagggcctggaactctgcct
ctggctgattggcaggagcccctggctccacctgctcgccggtggcgttctttgcctggt
tcaccagagttcttgcatcaagaggcctgtccatttgtgggccgagaagattcactatct
gacgggcccccaccacgcctcagtagtctcaagtacagagtaagagagatcccgccattc
cgagcatctgccctaccacctgttctggcccatgaagccatggactgctccagtccccaa
gaagaaaacggttttgggcccaggccccagggagctagtccatgccttgcaggtgcctct
gaggagatggaggtagaagaagaaaggccaagaagcttggctccagtcccgttttctgtc
tcaggcgtaggcctgaaaacccagggagaacaggatgggtga

DBGET integrated database retrieval system